Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD989196 score=273 PDB105F5 score=145 PD038572 score=151 PDC099J5 score=120 PDB075B9 score=225 PDC1X2X4 score=246 PD299296 score=242 PDA2S8S8 score=260 PDA1R8E9 score=218 PD782152 score=131 PD843782 score=105


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD989196
PDA2S8S8
PDC1X2X4
PD299296
PDB075B9
PDA1R8E9
PDA1C148
PDD0S802
PD038572
PD118203
PDB105F5
PD782152
PD877545
PDB2X3Y0
PDB7R4Y9
PDC099J5
PDA387Y6
PDC3V861
PDB0Y8J0
PD038571
PD843782
PDC7Z1Z5
PDB098L2
PDB7Q3H0
PDB7Q3N9
PDB1Q1N7



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(425 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      2-55  #PD989196                                            273 6e-27
     56-84  #PDB105F5                                            145 3e-09
    90-155  #PD038572                                            151 1e-09
   145-216  #PDC099J5                                            120 2e-05
   159-206  #PDB098L2                                            102 0.003
   185-234  #PDB7Q3H0                                            101 0.004
   185-239  #PDB075B9                                            225 4e-20
   185-223  #PD038571                                            107 0.0008
   185-227  #PD118203                                            149 2e-09
   185-211  #PDB7Q3N9                                            101 0.004
   215-260  #PDC1X2X4                                            246 3e-23
   252-354  #PD299296                                            242 4e-22
   280-350  #PDA1C148                                            212 6e-18
   287-339  #PDB7R4Y9                                            120 1e-05
   287-342  #PDC7Z1Z5                                            102 0.003
   288-379  #PDB1Q1N7                                             99 0.009
   288-359  #PD877545                                            123 7e-06
   293-378  #PDD0S802                                            156 3e-10
   338-384  #PDB2X3Y0                                            121 1e-05
   340-405  #PDA2S8S8                                            260 5e-25
   349-406  #PDA1R8E9                                            218 3e-19
   350-405  #PDA387Y6                                            119 2e-05
   350-406  #PDC3V861                                            118 2e-05
   351-416  #PD782152                                            131 5e-07
   351-406  #PDB0Y8J0                                            110 0.0002
   406-425  #PD843782                                            105 0.0008


>PD989196 (Closest domain: F4SQI5_ECOLX 2-55)
Number of domains in family: 249
Commentary (automatic):
MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID BRANCHED-CHAIN FULL=HIGH-AFFINITY  
Length = 54
Score = 273  (109.8 bits), Expect = 6e-27
Identities = 54/54 (100%), Positives = 54/54 (100%)

 Query:      2 KPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVV 55
               KPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVV
 Sbjct:      2 KPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVV 55

>PDA2S8S8 (Closest domain: C9QWI0_ECOD1 340-405) Number of domains in family: 135 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID ABC BRANCHED-CHAIN Length = 66 Score = 260 (104.8 bits), Expect = 5e-25 Identities = 54/66 (81%), Positives = 54/66 (81%)
 Query:    340 ESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXI 399
               ESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYS            I
 Sbjct:    340 ESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSMLMLGGLMVLMMI 399

 Query:    400 WRPQGL 405
               WRPQGL
 Sbjct:    400 WRPQGL 405

>PDC1X2X4 (Closest domain: Q0SZL6_SHIF8 192-240) Number of domains in family: 322 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID BRANCHED-CHAIN ABC Length = 49 Score = 246 (99.4 bits), Expect = 3e-23 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Query:    215 ITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDR 260
               ITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDR
 Sbjct:    192 ITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDR 237

>PD299296 (Closest domain: Q2RTJ5_RHORT 275-377) Number of domains in family: 2299 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO ACID TRANSLOCATOR Length = 103 Score = 242 (97.8 bits), Expect = 4e-22 Identities = 48/103 (46%), Positives = 59/103 (57%)
 Query:    252 GLKYDPSDRXXXXXXXXXXXXXXXXXXXNRLLRMPLGRAWEALREDEIACRSLGLSPRRI 311
               G+ Y P  R                    R+ R+P+GRAWEALREDEIACRSLG++P  +
 Sbjct:    275 GISYSPDHRVIFLFYLILALAVLTNIFTGRIRRLPVGRAWEALREDEIACRSLGINPTNV 334

 Query:    312 KLTAFTISXXXXXXXXXXXXXRQGFVSPESFTFAESAFVLAIV 354
               KL+AF +              RQGF+SPESFTF ESA +LAIV
 Sbjct:    335 KLSAFALGAMFGGFAGSFFATRQGFISPESFTFMESAVILAIV 377

>PDB075B9 (Closest domain: C4ZLF6_THASP 187-254) Number of domains in family: 1235 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSLOCATOR Length = 68 Score = 225 (91.3 bits), Expect = 4e-20 Identities = 41/55 (74%), Positives = 51/55 (92%)
 Query:    185 PVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEFSRTA 239
               P+LRLRGDYLAIVTLGFGEI+RI+L+N TE +GGPNGIS IP+P+ FGL+F+R+A
 Sbjct:    200 PILRLRGDYLAIVTLGFGEIIRIILVNWTEFSGGPNGISSIPRPSFFGLDFTRSA 254

>PDA1R8E9 (Closest domain: G8WLT2_KLEOK 349-406) Number of domains in family: 510 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO TRANSPORTER ACID ABC PERMEASE Length = 58 Score = 218 (88.6 bits), Expect = 3e-19 Identities = 45/58 (77%), Positives = 46/58 (79%), Gaps = 4/58 (6%)
 Query:    349 FVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXIWRPQGLL 406
               FVLAIVVLGGMGSQFAVILAA+LLVVSRELMRDFNEYS            IWRPQGLL
 Sbjct:    349 FVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDFNEYSMLMLGALMVLMMIWRPQGLL 406

>PDA1C148 (Closest domain: G8Q4Y4_PSEFL 268-355) Number of domains in family: 646 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSLOCATOR Length = 88 Score = 212 (86.3 bits), Expect = 6e-18 Identities = 41/71 (57%), Positives = 49/71 (69%), Gaps = 4/71 (5%)
 Query:    280 NRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSP 339
               +RL RMP+GRAWEALREDEIACRS+GL+   +KL+AFTI               QGFV+P
 Sbjct:    285 HRLTRMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNP 344

 Query:    340 ESFTFAESAFV 350
                SFTF ESA +
 Sbjct:    345 SSFTFFESALI 355

>PDD0S802 (Closest domain: C4K9J9_THASP 218-303) Number of domains in family: 2 Commentary (automatic): SUBNAME: FULL=INNER-MEMBRANE TRANSLOCATOR FULL=PUTATIVE UNCHARACTERIZED Length = 86 Score = 156 (64.7 bits), Expect = 3e-10 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Query:    293 ALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSPESFTFAESAFVLA 352
               A+R+DE+A +++G++ R +KL AF +               QGFVSPESF+  ES  VL 
 Sbjct:    218 AMRDDELAAKAIGINTRDMKLLAFALGATFGGVAGALFGAFQGFVSPESFSLMESIAVLT 277

 Query:    353 IVVLGGMGSQFAVILAAILLVVSREL 378
               +VV GGMG+    ++ A +L +  EL
 Sbjct:    278 MVVFGGMGNLAGAVVGAFVLALLPEL 303

>PD038572 (Closest domain: A8AR09_CITK8 90-155) Number of domains in family: 986 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO ACID TRANSPORTER Length = 66 Score = 151 (62.8 bits), Expect = 1e-09 Identities = 35/66 (53%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
 Query:     90 KLFXXXXXXXXXXWPFMVSRGTVDIATLTMIYIIXXXXXXXXXXXXXXXXXXXXXFYAIG 149
               KLF          WPFMVSRGTVDIATLTMIYII                     FYAIG
 Sbjct:     90 KLFLIALLVIAVVWPFMVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIG 149

 Query:    150 AYTFAL 155
               AYTFAL
 Sbjct:    150 AYTFAL 155

>PD118203 (Closest domain: E1X1C7_BACMS 63-127) Number of domains in family: 88 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX FULL=INNER-MEMBRANE TRANSLOCATOR PERMEASE TRANSPORTER AMINO Length = 65 Score = 149 (62.0 bits), Expect = 2e-09 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Query:    185 PVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPK 227
               P LRLRGDYLAI TLGFGEI+RI+++ NT+  GGP G S IPK
 Sbjct:     85 PCLRLRGDYLAIATLGFGEIIRIVIM-NTDAIGGPRGFSGIPK 126

>PDB105F5 (Closest domain: Q1R5H2_ECOUT 56-84) Number of domains in family: 152 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID BRANCHED-CHAIN FULL=HIGH-AFFINITY Length = 29 Score = 145 (60.5 bits), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 1/29 (3%)
 Query:     56 FFFQLLRPAFQKGLKSVSGPKFILPAIDG 84
               FFFQLLRPAFQKGLKSVSGPKFILPAIDG
 Sbjct:     56 FFFQLLRPAFQKGLKSVSGPKFILPAIDG 84

>PD782152 (Closest domain: C6BSD4_DESAD 331-397) Number of domains in family: 274 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX FULL=INNER-MEMBRANE TRANSLOCATOR PERMEASE ACID AMINO Length = 67 Score = 131 (55.1 bits), Expect = 5e-07 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Query:    351 LAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXIWRPQGLLPMTR 410
               L+IVVLGGMGS   VIL A++L++  E MRDF+EY             ++RPQGL+   R
 Sbjct:    331 LSIVVLGGMGSILGVILGALVLILLPEYMRDFSEYRMLIFGATMVLVMVFRPQGLVRDVR 390

 Query:    411 PQLKLK 416
                ++ + 
 Sbjct:    391 KKIDIS 396

>PD877545 (Closest domain: A9B4R9_HERA2 398-474) Number of domains in family: 411 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSLOCATOR FULL=INNER-MEMBRANE PERMEASE ACID AMINO Length = 77 Score = 123 (52.0 bits), Expect = 7e-06 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
 Query:    288 GRAWEALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSPESFTFAES 347
               GRAW A+REDE+A  ++G++  R KL AF++                G + P SF F+ S
 Sbjct:    403 GRAWMAMREDELAADAMGINVVRTKLLAFSMGAMFSGFGGAFYGAFIGAIFPSSFDFSVS 462

 Query:    348 AFVLAIVVLGGM 359
                 +L +V+LGG+
 Sbjct:    463 IILLCMVILGGL 474

>PDB2X3Y0 (Closest domain: Q0K7B8_CUPNH 281-362) Number of domains in family: 193 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX FULL=INNER-MEMBRANE TRANSLOCATOR PERMEASE AMINO ACID Length = 82 Score = 121 (51.2 bits), Expect = 1e-05 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Query:    338 SPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNE 384
               SPESFT  ES +VLAIVVLGGMG    VIL  +LLV  +EL+R   E
 Sbjct:    281 SPESFTLWESIYVLAIVVLGGMGHIPGVILGGVLLVGFQELLRVVAE 327

>PDB7R4Y9 (Closest domain: B1Z484_BURA4 229-283) Number of domains in family: 792 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO TRANSPORTER ACID Length = 55 Score = 120 (50.8 bits), Expect = 1e-05 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Query:    287 LGRAWEALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSP 339
               +GRAW A+REDEIA +++G++ R +KL AF +               QGFVSP
 Sbjct:    231 IGRAWAAIREDEIAAKAMGINTRNVKLLAFAMGASFGGLSGAMFGSFQGFVSP 283

>PDC099J5 (Closest domain: E3HZQ4_RHOVT 32-135) Number of domains in family: 56 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID TRANSPORTER ABC PERMEASE Length = 104 Score = 120 (50.8 bits), Expect = 2e-05 Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Query:    145 FYAIGAYTFALLNHYYGLGFWTCLPIXXXXXXXXXXXXXXPVLRLRGDYLAIVTLGFGEI 204
                + IGAY  A++ H+YGLG W  L +              P LR+ G YLA+VTL FG I
 Sbjct:     64 LFGIGAYGAAVIFHHYGLGVWPGLLVGVIVTGIFGAVLAVPALRVIGPYLAMVTLAFGTI 123

 Query:    205 VRILLLNNTEIT 216
               ++I++   T +T
 Sbjct:    124 IQIVINEWTGLT 135

>PDA387Y6 (Closest domain: F3Z3R8_DESAF 330-386) Number of domains in family: 340 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO ACID TRANSLOCATOR Length = 57 Score = 119 (50.4 bits), Expect = 2e-05 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Query:    350 VLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXIWRPQGL 405
               +L+IVVLGGMGS   VIL A +L++  E MR F+EY             ++RPQGL
 Sbjct:    330 ILSIVVLGGMGSILGVILGAFILILLPEYMRAFSEYRMLLFGAIMVLVMVFRPQGL 385

>PDC3V861 (Closest domain: B8J0V5_DESDA 330-387) Number of domains in family: 537 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ABC ACID PERMEASE TRANSPORTER Length = 58 Score = 118 (50.1 bits), Expect = 2e-05 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 4/57 (7%)
 Query:    350 VLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXIWRPQGLL 406
               +L++VVLGGMGS   V++AA++L+++ E +R F+EY             I+RPQGL+
 Sbjct:    331 ILSMVVLGGMGSITGVVIAALILILAPEYLRAFSEYRMLIFGAIMVIMMIFRPQGLI 387

>PDB0Y8J0 (Closest domain: D9SUP0_CLOC7 238-299) Number of domains in family: 338 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX ABC PERMEASE TRANSPORTER FULL=UREA AMINO Length = 62 Score = 110 (47.0 bits), Expect = 0.0002 Identities = 26/56 (46%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Query:    351 LAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSXXXXXXXXXXXXIWRPQGLL 406
               L  VV GGMGS    +LA ILL    EL+RD N+Y             I+RPQGLL
 Sbjct:    241 LTFVVFGGMGSLSGSVLATILLTFLPELLRDLNDYRMIIYPLALILLMIFRPQGLL 296

>PD038571 (Closest domain: A0RWY0_CENSY 76-161) Number of domains in family: 150 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX ACID AMINO PERMEASE ABC FULL=INNER-MEMBRANE Length = 86 Score = 107 (45.8 bits), Expect = 0.0008 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 1/39 (2%)
 Query:    185 PVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGIS 223
               P +RLRGDYLAI  L FGEI+RI+ +N   + GG  G+S
 Sbjct:    114 PAVRLRGDYLAITLLAFGEIIRIVGINYEPLVGGTLGVS 152

>PD843782 (Closest domain: C9QWI0_ECOD1 406-425) Number of domains in family: 47 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID FULL=HIGH-AFFINITY PERMEASE BRANCHED-CHAIN Length = 20 Score = 105 (45.1 bits), Expect = 0.0008 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 1/20 (5%)
 Query:    406 LPMTRPQLKLKNGAAKGEQA 425
               LPMTRPQLKLKNGAAKGEQA
 Sbjct:    406 LPMTRPQLKLKNGAAKGEQA 425

>PDC7Z1Z5 (Closest domain: Q5SIN7_THET8 292-348) Number of domains in family: 6 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE TRANSPORTER BRANCHED-CHAIN Length = 57 Score = 102 (43.9 bits), Expect = 0.003 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Query:    287 LGRAWEALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSPESF 342
                GRAW A+REDEIA +++G+     KL AF                ++ FVSPESF
 Sbjct:    293 FGRAWVAIREDEIAAQAMGIPLLPTKLIAFMTGAAFSGVMGVIYGAQRTFVSPESF 348

>PDB098L2 (Closest domain: A7IMN4_XANP2 79-126) Number of domains in family: 727 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSLOCATOR FULL=INNER-MEMBRANE PERMEASE AMINO ABC Length = 48 Score = 102 (43.9 bits), Expect = 0.003 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Query:    159 YYGLGFWTCLPIXXXXXXXXXXXXXXPVLRLRGDYLAIVTLGFGEIVR 206
               ++G+GFW  LP+              P LR+ G YLA+VTL FG IV+
 Sbjct:     79 HFGIGFWPALPLAIIVTALFGIVLALPALRVTGPYLAMVTLAFGTIVQ 126

>PDB7Q3H0 (Closest domain: E3JC28_FRASU 403-464) Number of domains in family: 27 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSPORTER ATP-BINDING FULL=ABC RELATED ABC Length = 62 Score = 101 (43.5 bits), Expect = 0.004 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Query:    185 PVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLE 234
               P +R+RG  LAIVTLG    V  L+L+  ++TGG +G+  I +P LFGL+
 Sbjct:    416 PAVRVRGVNLAIVTLGLSLAVENLVLSQPKMTGGLDGL-HIHRPNLFGLD 464

>PDB7Q3N9 (Closest domain: E8ZTB4_CLOB0 95-132) Number of domains in family: 168 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSPORTER AMINO FULL=INNER-MEMBRANE TRANSLOCATOR ABC Length = 38 Score = 101 (43.5 bits), Expect = 0.004 Identities = 18/27 (66%), Positives = 25/27 (92%), Gaps = 1/27 (3%)
 Query:    185 PVLRLRGDYLAIVTLGFGEIVRILLLN 211
               P LR++G+YL I+TLGFGEIV+++LLN
 Sbjct:    104 PSLRVKGNYLCIITLGFGEIVKLILLN 130

>PDB1Q1N7 (Closest domain: D5CS76_SIDLE 182-273) Number of domains in family: 31 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSPORTER FULL=INNER-MEMBRANE TRANSLOCATOR ABC RELATED Length = 92 Score = 99 (42.7 bits), Expect = 0.009 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Query:    288 GRAWEALREDEIACRSLGLSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSPESFTFAES 347
               GRA+EALR+  IA  ++G+   R K+ AF +                 F+ P SF +   
 Sbjct:    182 GRAFEALRDSPIATDAMGVGVFRHKVAAFALGSGLGGLAGGLYAFNFQFLQPNSFVYELM 241

 Query:    348 AFVLAIVVLGGMGSQFAVILAAILLVVSRELM 379
                 +L  VVLGG  S +   + A L+V+   L+
 Sbjct:    242 VILLLGVVLGGRKSLWGAFIGACLIVLLPNLL 273