Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=278 PD786156 score=309 PDA1V4U2 score=192 PD414066 score=283 PDA857M8 score=152 PDB197S1 score=229 PDB0D1K9 score=162 PDA9T8H7 score=319 PD827414 score=278 PDE1X5Q0 score=107


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA9T8H7
PD786156
PD414066
PD526846
PD827414
PDB197S1
PDA1V4U2
PDB5H8I3
PDA2K3G9
PDB0D1K9
PDC7L8T4
PDC66453
PDA857M8
PDB3L707
PDA026V7
PDC657H6
PD869429
PD927405
PDA210O4
PDC650L5
PDC5N1H8
PD482214
PDB0F632
PD869428
PDA857O4
PDE1X5Q0
PDC69598
PD925716
PDC7N0T0
PDB3K644
PDA1P539
PDC6N7U7
PD900101
PDC677U8

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDA9T8H7
PD786156
PD414066
PD526846
PDB197S1
PDA1V4U2
PDB5H8I3
PDA2K3G9
PDB0D1K9
PD869429
PD482214
PDB3K644

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDA9T8H7
PD786156
PD414066
PD526846
PDB197S1
PDA1V4U2
PDB5H8I3
PDA2K3G9
PDB0D1K9
PD869429
PD482214
PDB3K644


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(346 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

     14-67  #PD526846                                            278 6e-28
     27-70  #PD869428                                            111 0.0002
    52-112  #PD786156                                            309 3e-32
     60-84  #PDC69598                                            104 0.0009
    72-179  #PDC7L8T4                                            161 5e-11
    75-127  #PDB5H8I3                                            190 1e-15
    77-132  #PD925716                                            104 0.001
    78-116  #PDB3K644                                            103 0.001
    81-114  #PDC650L5                                            115 3e-05
    83-140  #PDA1V4U2                                            192 8e-16
    84-139  #PDA1P539                                            100 0.004
    84-132  #PDA210O4                                            121 6e-06
    84-174  #PDA2K3G9                                            178 2e-13
    84-130  #PDB3L707                                            149 8e-10
   118-173  #PDC66453                                            156 9e-11
   119-219  #PDA857M8                                            152 9e-10
   127-168  #PDC657H6                                            143 4e-09
   128-175  #PDA026V7                                            143 5e-09
   132-183  #PD414066                                            283 1e-28
   154-177  #PDC677U8                                             97 0.008
   176-228  #PD482214                                            114 6e-05
   203-246  #PDB197S1                                            229 3e-21
   213-279  #PD927405                                            122 6e-06
   237-267  #PDB0D1K9                                            162 1e-11
   238-281  #PD900101                                             98 0.006
   239-325  #PDC6N7U7                                             99 0.007
   239-323  #PDA857O4                                            108 0.0005
   239-276  #PDB0F632                                            112 9e-05
   260-324  #PDA9T8H7                                            319 1e-33
   261-328  #PD869429                                            138 4e-08
   276-332  #PD827414                                            278 8e-28
   284-322  #PDC5N1H8                                            115 3e-05
   284-325  #PDC7N0T0                                            104 0.001
   296-333  #PDE1X5Q0                                            107 0.0004


>PDA9T8H7 (Closest domain: G8V412_STAAU 260-324)
Number of domains in family: 658
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE DEAMINASE  
Length = 65
Score = 319  (127.5 bits), Expect = 1e-33
Identities = 63/65 (96%), Positives = 64/65 (98%)

 Query:    260 LVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILSGKIDKKWLEDKNVVALVSG 319
               LVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILSGKI+ KWLEDKNVVALVSG
 Sbjct:    260 LVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILSGKINNKWLEDKNVVALVSG 319

 Query:    320 GNVDL 324
               GNVDL
 Sbjct:    320 GNVDL 324

>PD786156 (Closest domain: D9RJ85_STAAK 52-112) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 61 Score = 309 (123.6 bits), Expect = 3e-32 Identities = 60/61 (98%), Positives = 61/61 (100%)
 Query:     52 LKLENMQFTGSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGINATIVM 111
               LKLENMQFTGSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGI+ATIVM
 Sbjct:     52 LKLENMQFTGSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGIDATIVM 111

 Query:    112 P 112
               P
 Sbjct:    112 P 112

>PD414066 (Closest domain: G8V412_STAAU 132-189) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 58 Score = 283 (113.6 bits), Expect = 1e-28 Identities = 52/52 (100%), Positives = 52/52 (100%)
 Query:    132 LKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIWNVN 183
               LKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIWNVN
 Sbjct:    132 LKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIWNVN 183

>PD526846 (Closest domain: TDCB_STAA3 14-67) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 54 Score = 278 (111.7 bits), Expect = 6e-28 Identities = 54/54 (100%), Positives = 54/54 (100%)
 Query:     14 VSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFTGSFKFRG 67
               VSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFTGSFKFRG
 Sbjct:     14 VSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFTGSFKFRG 67

>PD827414 (Closest domain: G8RFR2_STAAU 276-332) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 57 Score = 278 (111.7 bits), Expect = 8e-28 Identities = 55/57 (96%), Positives = 56/57 (98%)
 Query:    276 MKDLMQRAKIITEGAGALPTAAILSGKIDKKWLEDKNVVALVSGGNVDLTRVSGVIE 332
               MKDLMQRAKIITEGAGALPTAAILSGKI+ KWLEDKNVVALVSGGNVDLTRVSGVIE
 Sbjct:    276 MKDLMQRAKIITEGAGALPTAAILSGKINNKWLEDKNVVALVSGGNVDLTRVSGVIE 332

>PDB197S1 (Closest domain: E5QVX9_STAAH 202-246) Number of domains in family: 224 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 CATABOLIC DEHYDRATASE THREONINE FULL=CATABOLIC DEAMINASE Length = 45 Score = 229 (92.8 bits), Expect = 3e-21 Identities = 43/44 (97%), Positives = 43/44 (97%)
 Query:    203 KSFNPSIHIIGVQSENVHGMAESFYKRDLTEHRDDSTIADGCDV 246
               KSFNPSIHIIGVQSENVHGMAESFYKRDLTEHR DSTIADGCDV
 Sbjct:    203 KSFNPSIHIIGVQSENVHGMAESFYKRDLTEHRVDSTIADGCDV 246

>PDA1V4U2 (Closest domain: A0Q0J5_CLONN 71-128) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 58 Score = 192 (78.6 bits), Expect = 8e-16 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 5/58 (8%)
 Query:     83 GIIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQVILKGKNFNET 140
               G+IA+SAGNHAQGVA  A   G+ +TIVMP TAPQAK +ATKGYGA+V+  G+ ++E 
 Sbjct:     71 GVIASSAGNHAQGVAYAATAFGVKSTIVMPATAPQAKVEATKGYGAEVVQYGQVYDEC 128

>PDB5H8I3 (Closest domain: G4Q3Q6_ACIIR 64-118) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 55 Score = 190 (77.8 bits), Expect = 1e-15 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 5/53 (9%)
 Query:     75 LTDEQKEKGIIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYG 127
               L+ EQKE+GIIAASAGNHAQGVAL   +  I +T+VMPE AP AK QATKGYG
 Sbjct:     66 LSPEQKERGIIAASAGNHAQGVALGGTMNAIRSTVVMPEAAPLAKVQATKGYG 118

>PDA2K3G9 (Closest domain: SRR_BOVIN 79-169) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 91 Score = 178 (73.2 bits), Expect = 2e-13 Identities = 34/91 (37%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Query:     84 IIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQVILKGKNFNETRLY 143
               ++A S+GNH Q ++  A+L GI A +++PETAP  K+ A + YGA ++   ++       
 Sbjct:     79 VVAHSSGNHGQALSFAARLEGIPAYVIVPETAPNCKKLAIQAYGASIVYSEQSEESRENI 138

 Query:    144 MEELAKENGMTIVHPYDDKFVMAGQGTIGLE 174
                + +A+E    +VHP  +  V+AGQGTI +E
 Sbjct:    139 TKRIAEETEGIMVHPNQEPAVIAGQGTIAME 169

>PDB0D1K9 (Closest domain: G8RFR2_STAAU 237-267) Number of domains in family: 538 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEAMINASE FULL=L-THREONINE DEHYDRATASE Length = 31 Score = 162 (67.0 bits), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 3/31 (9%)
 Query:    237 DSTIADGCDVKVPGEQTYEVVKHLVDEFILV 267
               DSTIADGCDVKVPGEQTYEVVKHLVDEFILV
 Sbjct:    237 DSTIADGCDVKVPGEQTYEVVKHLVDEFILV 267

>PDC7L8T4 (Closest domain: E4UQ89_ARTGP 85-200) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 116 Score = 161 (66.6 bits), Expect = 5e-11 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 6/114 (5%)
 Query:     72 INHLTDEQKEKGIIAASAGNHAQGVALTAKLLG------INATIVMPETAPQAKQQATKG 125
               ++ ++DE+ E+GI+  S GNHA      A LL       I     MP TA + K    + 
 Sbjct:     85 LSRMSDERLERGIVVFSTGNHAFASGYAASLLSRMRGVQIPVHAFMPPTASKTKVYLAES 144

 Query:    126 YGAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDI 179
                G QV L G +  E     E  A+  G +++ P DD  ++ G G++G+EI+D +
 Sbjct:    145 QGVQVHLSGNSVTECMQIAEAFAESLGTSVLAPADDYDIIRGHGSVGIEIIDQM 198

>PDC66453 (Closest domain: Q890M3_CLOTE 108-163) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 56 Score = 156 (64.7 bits), Expect = 9e-11 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (1%)
 Query:    118 AKQQATKGYGAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGL 173
               AK  ATKGYGA+VI  G+ ++E  +   +  KENG T +HP+DD+ V+AGQGTIGL
 Sbjct:    108 AKVNATKGYGAKVIQCGEVYDECYIKALQTQKENGYTFIHPFDDEQVIAGQGTIGL 163

>PDA857M8 (Closest domain: D1C1H4_SPHTD 113-225) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 113 Score = 152 (63.2 bits), Expect = 9e-10 Identities = 32/101 (31%), Positives = 57/101 (56%), Gaps = 2/101 (1%)
 Query:    119 KQQATKGYGAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDD 178
               K  + +  GA+V+L G++F+E RL  EE A+ +GM  +H  ++  ++AG GT  LE+++ 
 Sbjct:    116 KVASMRRLGAEVVLTGRDFDEARLAAEERAERDGMRYIHSANEPDLIAGVGTYALEMIEA 175

 Query:    179 IWNVNXXXXXXXXXXXXXXXXXXXKSFNPSIHIIGVQSENV 219
               + +++                   K+ NP+I +IGVQSE +
 Sbjct:    176 VPDLDTVIVPVGAGSGVCGTAIVMKAVNPAIRVIGVQSEEM 216

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 149 (62.0 bits), Expect = 8e-10 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Query:     84 IIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQV 130
               ++AASAGNHAQGVAL + LLG  +T+ MP  AP  K  AT+GYGA V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PDA026V7 (Closest domain: Q39R38_GEOMG 115-162) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 48 Score = 143 (59.7 bits), Expect = 5e-09 Identities = 27/48 (56%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Query:    128 AQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEI 175
               A V+L G+NF+E      +  KE G   VHP+DD  VMAGQGTIGLEI
 Sbjct:    115 ADVVLTGRNFDEAYAAAVQAQKETGALFVHPFDDPLVMAGQGTIGLEI 162

>PDC657H6 (Closest domain: A7H425_CAMJD 114-155) Number of domains in family: 135 Commentary (automatic): SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 42 Score = 143 (59.7 bits), Expect = 4e-09 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 2/42 (4%)
 Query:    127 GAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQ 168
               GA+VILKG NF+E   +    AKEN ++ +HP+DD+FVMAGQ
 Sbjct:    114 GAEVILKGDNFDEAYAFATSYAKENNLSFIHPFDDEFVMAGQ 155

>PD869429 (Closest domain: F4W013_ECOLX 255-322) Number of domains in family: 50 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 CATABOLIC ILVA THREONINE BETA SUBUNIT Length = 68 Score = 138 (57.8 bits), Expect = 4e-08 Identities = 36/68 (52%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Query:    261 VDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILSGKIDKKWLEDKNVVALVSGG 320
               VD+ +LV+E+EI ++M  L+QR K++TEGAGAL  AA+LSGK+D ++++++  V+++SGG
 Sbjct:    255 VDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLD-QYIQNRKTVSIISGG 313

 Query:    321 NVDLTRVS 328
               N+DL+RVS
 Sbjct:    314 NIDLSRVS 321

>PD927405 (Closest domain: C7YIV4_NECH7 270-339) Number of domains in family: 543 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEHYDRATASE FULL=L-THREONINE THREONINE Length = 70 Score = 122 (51.6 bits), Expect = 6e-06 Identities = 26/67 (38%), Positives = 43/67 (64%), Gaps = 2/67 (2%)
 Query:    213 GVQSENVHGMAESFYKRDLTEHRDDSTIADGCDVKVPGEQTYEVVKHLVDEFILVTEEEI 272
               GV++ + + MAES  K +    ++    ADG  VK+PGE+T+ + K +VD+ I V+ +EI
 Sbjct:    270 GVEAGDANAMAESLKKGERVLLKEVGLFADGAAVKIPGEETFRIAKDVVDDVIEVSTDEI 329

 Query:    273 EHAMKDL 279
                 A+KD+
 Sbjct:    330 CAAIKDM 336

>PDA210O4 (Closest domain: B9LBZ4_CHLSY 73-122) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 50 Score = 121 (51.2 bits), Expect = 6e-06 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 7/49 (14%)
 Query:     84 IIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQVIL 132
               ++A SAGNHA GVA TA L G  AT+V+P TA  AK  A + Y  +VIL
 Sbjct:     73 VVACSAGNHALGVAHTAALTGTPATLVVPTTASPAKVTALRRYPVEVIL 121

>PDC650L5 (Closest domain: G2K6R3_LISMO 74-107) Number of domains in family: 178 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 34 Score = 115 (48.9 bits), Expect = 3e-05 Identities = 22/34 (64%), Positives = 26/34 (76%), Gaps = 8/34 (23%)
 Query:     81 EKGIIAASAGNHAQGVALTAKLLGINATIVMPET 114
               EKG++ ASAGNHAQGVA T K + + ATI MP T
 Sbjct:     74 EKGVVCASAGNHAQGVAYTCKRMTVPATIFMPTT 107

>PDC5N1H8 (Closest domain: C4LVZ3_ENTHI 297-334) Number of domains in family: 16 Commentary (automatic): SUBNAME: FULL=THREONINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT DEHYDRATASE BETA SUBUNIT EC=4.3.1.19 LYASE FULL=DEHYDRATASE CATABOLIC Length = 38 Score = 115 (48.9 bits), Expect = 3e-05 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%)
 Query:    284 KIITEGAGALPTAAILSGKIDKKWLEDKNVVALVSGGNV 322
               KI++EG+GA P AA+LSGKI K   ED NVV +VSGGN+
 Sbjct:    297 KIVSEGSGATPVAALLSGKI-KGLTEDTNVVCIVSGGNL 334

>PD482214 (Closest domain: A1JIM7_YERE8 170-222) Number of domains in family: 1906 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 53 Score = 114 (48.5 bits), Expect = 6e-05 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Query:    176 LDDIWNVNXXXXXXXXXXXXXXXXXXXKSFNPSIHIIGVQSENVHGMAESFYK 228
               L+D+++V+                   KS NP+I+IIGVQSENVHGMA S+Y 
 Sbjct:    170 LEDLYDVDNVIVPIGGGGLISGIALAIKSINPTINIIGVQSENVHGMAASYYS 222

>PDB0F632 (Closest domain: A4FF54_SACEN 203-263) Number of domains in family: 53 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE EC=4.3.1.19 THREONINE FULL=PUTATIVE Length = 61 Score = 112 (47.8 bits), Expect = 9e-05 Identities = 22/38 (57%), Positives = 29/38 (76%), Gaps = 1/38 (2%)
 Query:    239 TIADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAM 276
               TIADG  +  PGE T+EVV+ LVDE +LV+++EI  AM
 Sbjct:    226 TIADGQAITAPGELTFEVVRRLVDEVVLVSDDEIRAAM 263

>PD869428 (Closest domain: A7EL82_SCLS1 18-79) Number of domains in family: 289 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE FULL=L-SERINE DEHYDRATASE FULL=PUTATIVE EC=4.2.3.1 EC=4.3.1.17 UNCHARACTERIZED Length = 62 Score = 111 (47.4 bits), Expect = 0.0002 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (4%)
 Query:     27 KPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFTGSFKFRGASN 70
               KP+IR TPL++S  LS+ I   NV+LKLEN+Q +GSFK RG  N
 Sbjct:     18 KPWIR-TPLVRSAALSR-IAGCNVWLKLENLQPSGSFKSRGIGN 59

>PDA857O4 (Closest domain: Q7VZT8_BORPE 224-309) Number of domains in family: 91 Commentary (automatic): SUBNAME: LYASE DEHYDRATASE BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE FULL=THREONINE EC=4.3.1.19 THREONINE Length = 86 Score = 108 (46.2 bits), Expect = 0.0005 Identities = 37/87 (42%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Query:    239 TIADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAI 298
               TIA+G  VK PG  T E+V  LVD   LV E +IEHA+  L++  K + EGAGA   AA+
 Sbjct:    224 TIAEGIAVKSPGTLTQEIVTRLVDHIELVNESDIEHAIVVLLEIEKTVVEGAGAAGLAAL 283

 Query:    299 --LSGKIDKKWLEDKNVVALVSGGNVD 323
                 L  + D+++   K +  +++GGN+D
 Sbjct:    284 LRLQERRDERF-RGKRLGLVLTGGNID 309

>PDE1X5Q0 (Closest domain: D5TKJ4_BACT1 289-333) Number of domains in family: 1 Commentary (automatic): FULL=THREONINE SUBNAME: DEHYDRATASE Length = 45 Score = 107 (45.8 bits), Expect = 0.0004 Identities = 22/38 (57%), Positives = 31/38 (81%), Gaps = 1/38 (2%)
 Query:    296 AAILSGKIDKKWLEDKNVVALVSGGNVDLTRVSGVIEH 333
               AA+L+GK+D  +++ K VVA++SGGNVDL R+S V EH
 Sbjct:    289 AALLAGKVDS-YIKGKKVVAVISGGNVDLQRISSVCEH 325

>PDC69598 (Closest domain: C7RHX8_ANAPD 44-68) Number of domains in family: 61 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE THREONINE UNCHARACTERIZED AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 25 Score = 104 (44.7 bits), Expect = 0.0009 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 2/25 (8%)
 Query:     60 TGSFKFRGASNKINHLTDEQKEKGI 84
               TGSFK RGA NKI HLTDEQK+KG+
 Sbjct:     44 TGSFKLRGAFNKIAHLTDEQKKKGV 68

>PD925716 (Closest domain: G2PL89_MURRD 50-115) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 66 Score = 104 (44.7 bits), Expect = 0.001 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Query:     77 DEQKEKGIIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQVIL 132
               D  K   +I A++GN   G+A+ A L G++  +VMPE + + + Q  + YGA+V L
 Sbjct:     58 DFTKSTKLIEATSGNTGIGLAMIAGLFGLDIELVMPENSTKERVQTMRAYGAKVTL 113

>PDC7N0T0 (Closest domain: G4KT28_OSCVS 265-306) Number of domains in family: 8 Commentary (automatic): SUBNAME: EC=4.3.1.19 LYASE FULL=THREONINE CATABOLIC AMMONIA-LYASE DEHYDRATASE THREONINE FULL=PUTATIVE DEHYDRATASE Length = 42 Score = 104 (44.7 bits), Expect = 0.001 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Query:    284 KIITEGAGALPTAAILSGKIDKKWLEDKNVVALVSGGNVDLT 325
               K + EGAGA P AA++ GK+D     +K  V +VSGGNVD+T
 Sbjct:    267 KTVAEGAGATPVAAVMFGKVDA---ANKKTVCVVSGGNVDVT 305

>PDB3K644 (Closest domain: SRR_HUMAN 68-111) Number of domains in family: 7 Commentary (automatic): SUBNAME: ALTNAME: FULL=SERINE RACEMASE FULL=D-SERINE DEACETYLASE FULL=L-SERINE AMMONIA-LYASE FULL=ACETYLORNITHINE EC=4.3.1.17 Length = 44 Score = 103 (44.3 bits), Expect = 0.001 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 1/39 (2%)
 Query:     78 EQKEKGIIAASAGNHAQGVALTAKLLGINATIVMPETAP 116
               E+K K ++  S+GNH Q +   AKL GI A IV+P+TAP
 Sbjct:     73 ERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAP 111

>PDA1P539 (Closest domain: Q3KDV0_PSEPF 136-195) Number of domains in family: 754 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 FULL=L-THREONINE REFERENCE THREONINE FULL=PUTATIVE THRC Length = 60 Score = 100 (43.1 bits), Expect = 0.004 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Query:     84 IIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQQATKGYGAQVILKGKNFNE 139
               +  AS GN A  +A  +  LG++  I +P +AP+ K+   +GYGA+++L    ++E
 Sbjct:    136 VAVASTGNAASALAGMSASLGLHNVIYLPRSAPREKRAQMQGYGAEIVLVDGQYDE 191

>PDC6N7U7 (Closest domain: Q9ZD93_RICPR 223-318) Number of domains in family: 21 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 DEHYDRATASE-LIKE EC=2.3.1.129 TDCB EC=4.3.1.16 EC=5.1.1.- Length = 96 Score = 99 (42.7 bits), Expect = 0.007 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 11/91 (12%)
 Query:    239 TIADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAI 298
               TIADG        +T+E +K L D F L  E EI +    L    K+I E + ++  A++
 Sbjct:    231 TIADGLKTLSVSARTFEYLKKL-DHFYLAEEYEIYYWTAWLTHLLKVICEPSSSINMASV 289

 Query:    299 LSGKIDKKWLEDKN----VVALVSGGNVDLT 325
               +S      WL+ +     ++ L+SGGN+D T
 Sbjct:    290 VS------WLKTQTKTQKLLVLISGGNIDPT 314

>PD900101 (Closest domain: B8J632_ANAD2 224-268) Number of domains in family: 68 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE FULL=PUTATIVE REFERENCE UNCHARACTERIZED EC=4.3.1.19 LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA Length = 45 Score = 98 (42.4 bits), Expect = 0.006 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Query:    238 STIADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQ 281
               ST+ADG  VK  G+ T+E V+ LVDE + V+EEEI  A+  L++
 Sbjct:    225 STVADGIAVKRAGDLTFEHVRRLVDEIVTVSEEEIASAILYLLE 268

>PDC677U8 (Closest domain: E3IBV7_GEOS0 141-165) Number of domains in family: 81 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 25 Score = 97 (42.0 bits), Expect = 0.008 Identities = 18/24 (75%), Positives = 21/24 (87%), Gaps = 1/24 (4%)
 Query:    154 TIVHPYDDKFVMAGQGTIGLEILD 177
               T VHP+DD  VMAGQGTIGLEI++
 Sbjct:    141 TFVHPFDDLAVMAGQGTIGLEIIE 164