Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC639P3 score=192 PDB001C9 score=146 PD717815 score=484 PDC639N6 score=204 PD132213 score=182 PDC636B9 score=439


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(304 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

     24-60  #PDC639P3                                            192 3e-16
     62-89  #PDB001C9                                            146 9e-10
    90-180  #PD717815                                            484 4e-58
   176-294  #PD132213                                            182 4e-14
   181-220  #PDC639N6                                            204 5e-18
   222-303  #PDC636B9                                            439 2e-51


>PD717815 (Closest domain: D8ERN1_ECOLX 327-417)
Number of domains in family: 418
Commentary (automatic):
REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE  
Length = 91
Score = 484  (191.0 bits), Expect = 4e-58
Identities = 91/91 (100%), Positives = 91/91 (100%)

 Query:     90 LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK 149
               LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK
 Sbjct:    327 LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK 386

 Query:    150 TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA 180
               TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA
 Sbjct:    387 TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA 417

>PDC636B9 (Closest domain: F4W231_ECOLX 409-490) Number of domains in family: 1311 Commentary (automatic): REDUCTOISOMERASE ALTNAME: FULL=KETOL-ACID BIOSYNTHESIS EC=1.1.1.86 AMINO-ACID AMINO BRANCHED-CHAIN ISOMEROREDUCTASE FULL=ALPHA-KETO-BETA-HYDROXYLACIL Length = 82 Score = 439 (173.7 bits), Expect = 2e-51 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Query:    222 MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH 281
               MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH
 Sbjct:    409 MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH 468

 Query:    282 AIEQVGKKLRGYMTDMKRIAVA 303
               AIEQVGKKLRGYMTDMKRIAVA
 Sbjct:    469 AIEQVGKKLRGYMTDMKRIAVA 490

>PDC639N6 (Closest domain: D7YG16_ECOLX 418-457) Number of domains in family: 418 Commentary (automatic): REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 40 Score = 204 (83.2 bits), Expect = 5e-18 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 2/40 (5%)
 Query:    181 GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY 220
               GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY
 Sbjct:    418 GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY 457

>PDC639P3 (Closest domain: F0JWU4_ESCFE 211-247) Number of domains in family: 414 Commentary (automatic): REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 37 Score = 192 (78.6 bits), Expect = 3e-16 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 3/37 (8%)
 Query:     24 VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP 60
               VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP
 Sbjct:    211 VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP 247

>PD132213 (Closest domain: D3DJS6_HYDTT 204-326) Number of domains in family: 1573 Commentary (automatic): REDUCTOISOMERASE ALTNAME: FULL=KETOL-ACID EC=1.1.1.86 ISOMEROREDUCTASE FULL=ALPHA-KETO-BETA-HYDROXYLACIL FULL=ACETOHYDROXY-ACID RECNAME: BIOSYNTHESIS AMINO-ACID Length = 123 Score = 182 (74.7 bits), Expect = 4e-14 Identities = 51/127 (40%), Positives = 71/127 (55%), Gaps = 15/127 (11%)
 Query:    176 AMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYGNY 235
               A++KAG    FET++++G   E AY+E LHEL LI + I +  +  M   ISDTA+YG+ 
 Sbjct:    205 ALIKAG----FETLIEAGYQPEVAYFECLHELKLIVDLIYQYGIAGMRYSISDTAKYGDV 260

 Query:    236 LFSYACVPLLKPFMA----ELQPGDLGKAIPEGAVDNAQLRDVNEAI----RSHAIEQVG 287
                       L+KP M     E+Q G+  K   E  ++N   R V  A+    R HAIE+VG
 Sbjct:    261 TRGERIYQLVKPLMKEVLEEIQKGEFAK---EWILENQAGRPVFNALLEKDRKHAIEEVG 317

 Query:    288 KKLRGYM 294
               +KLR  M
 Sbjct:    318 EKLREMM 324

>PDB001C9 (Closest domain: C2DYC9_ECOLX 299-326) Number of domains in family: 415 Commentary (automatic): REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 28 Score = 146 (60.8 bits), Expect = 9e-10 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 10/28 (35%)
 Query:     62 YAEKLIQFGWETITEALKQGGITLMMDR 89
               YAEKLIQFGWETITEALKQGGITLMMDR
 Sbjct:    299 YAEKLIQFGWETITEALKQGGITLMMDR 326