Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC6E0A7 score=117 PDB6Q3E7 score=531 PDB8J2U0 score=799 PD868638 score=456 PDB0N1W7 score=282 PDB05295 score=214 PDB3P4N7 score=290 PDC8U9P2 score=190 PDB0U9Y7 score=110


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDB8J2U0
PDB6Q3E7
PD868638
PDB3P4N7
PDB0N1W7
PD588630
PDC0U2V8
PDC7X3B0
PDB1D788
PD713539
PDB05295
PDC678C1
PDC6Z242
PDC8U9P2
PDA1F7G3
PDD2K2V3
PD104370
PD987952
PDA44804
PDC645W6
PDC6K8L3
PDD0Y1D8
PDC648L5
PDC650B3
PDD123A8
PDB800A1
PDC647W4
PD811239
PD001961
PD330724
PDC5L4W2
PDC9G6H1
PDB0Q9O6
PDC6E0A7
PDA2O226
PDB068E5
PDC6B437
PD924485
PDB0U9Y7
PDD1F816
PDB320H7
PDB126G4
PDB5T5X6
PDA08133
PDC640Y7
PDC643C1
PDC6R9T9

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDB8J2U0
PDB6Q3E7
PD868638
PDB3P4N7
PDB0N1W7
PD588630
PDC0U2V8
PDB1D788
PD713539
PDC678C1
PDA1F7G3
PD104370
PDC645W6
PDC648L5
PDC650B3
PD811239
PD001961
PD924485

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDB8J2U0
PDB6Q3E7
PD868638
PDB3P4N7
PDB0N1W7
PD588630
PDC0U2V8
PDB1D788
PD713539
PDC678C1
PDA1F7G3
PD104370
PDC645W6
PDC648L5
PDC650B3
PD811239
PD001961
PD924485


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(309 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-20  #PDC6E0A7                                            117 1e-05
      3-21  #PDC6R9T9                                             96 0.008
     6-101  #PDB6Q3E7                                            531 5e-65
      8-72  #PDC6Z242                                            197 1e-16
      8-47  #PD713539                                            235 4e-22
      9-34  #PDB5T5X6                                             99 0.003
     10-68  #PDA08133                                             98 0.006
     10-53  #PDC6K8L3                                            147 9e-10
     10-90  #PD330724                                            124 3e-06
    21-168  #PDB8J2U0                                            799 9e-105
     48-97  #PDC0U2V8                                            259 2e-25
    51-126  #PDA44804                                            156 8e-11
     55-79  #PDC648L5                                            140 8e-09
    64-169  #PDC7X3B0                                            251 9e-24
    87-174  #PD868638                                            456 7e-54
    95-187  #PD588630                                            270 2e-26
   107-130  #PD811239                                            128 4e-07
   118-195  #PDD2K2V3                                            183 1e-14
   120-168  #PDB1D788                                            251 2e-24
   133-163  #PDC645W6                                            156 4e-11
   135-176  #PDC678C1                                            211 6e-19
   137-212  #PD987952                                            158 4e-11
   143-201  #PDA2O226                                            115 4e-05
   164-185  #PD924485                                            111 7e-05
   165-222  #PDD1F816                                            108 0.0002
   166-211  #PDC9G6H1                                            118 1e-05
   173-234  #PDC5L4W2                                            123 3e-06
   173-226  #PDB0N1W7                                            282 1e-28
   175-200  #PDC650B3                                            134 6e-08
   178-201  #PD001961                                            126 7e-07
   179-256  #PDB05295                                            214 6e-19
   182-220  #PDB126G4                                            101 0.002
   182-227  #PDC647W4                                            133 9e-08
   191-229  #PDB068E5                                            115 2e-05
   191-245  #PDB0Q9O6                                            118 1e-05
   203-238  #PDA1F7G3                                            186 2e-15
   223-287  #PD104370                                            180 3e-14
   226-269  #PDB800A1                                            133 8e-08
   233-296  #PDD0Y1D8                                            146 2e-09
   240-301  #PDC8U9P2                                            190 1e-15
   241-296  #PDB3P4N7                                            290 8e-30
   243-280  #PDB320H7                                            102 0.001
   247-289  #PDD123A8                                            133 7e-08
   252-308  #PDB0U9Y7                                            110 0.0002
   261-289  #PDC640Y7                                             98 0.004
   263-295  #PDC6B437                                            115 2e-05
   273-305  #PDC643C1                                             96 0.008


>PDB8J2U0 (Closest domain: C2DYD3_ECOLX 21-168)
Number of domains in family: 103
Commentary (automatic):
AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID  
Length = 148
Score = 799  (312.4 bits), Expect = 9e-105
Identities = 148/148 (100%), Positives = 148/148 (100%)

 Query:     21 AKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELM 80
               AKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELM
 Sbjct:     21 AKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELM 80

 Query:     81 EACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGI 140
               EACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGI
 Sbjct:     81 EACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGI 140

 Query:    141 DAMVSSWNRAAPNTIPTAAKAGGNYLSS 168
               DAMVSSWNRAAPNTIPTAAKAGGNYLSS
 Sbjct:    141 DAMVSSWNRAAPNTIPTAAKAGGNYLSS 168

>PDB6Q3E7 (Closest domain: Q1R4G7_ECOUT 6-101) Number of domains in family: 553 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO PHOSPHATE PYRIDOXAL ACID FULL=BRANCHED-CHAIN EC=2.6.1.42 CHAIN Length = 96 Score = 531 (209.1 bits), Expect = 5e-65 Identities = 96/96 (100%), Positives = 96/96 (100%)
 Query:      6 ADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSA 65
               ADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSA
 Sbjct:      6 ADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSA 65

 Query:     66 KIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLI 101
               KIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLI
 Sbjct:     66 KIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLI 101

>PD868638 (Closest domain: ILVE_ECO57 87-174) Number of domains in family: 407 Commentary (automatic): AMINOTRANSFERASE SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE LYASE AMINO ACID FULL=BRANCHED-CHAIN EC=2.6.1.42 Length = 88 Score = 456 (180.3 bits), Expect = 7e-54 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 1/88 (1%)
 Query:     87 IRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSS 146
               IRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSS
 Sbjct:     87 IRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSS 146

 Query:    147 WNRAAPNTIPTAAKAGGNYLSSLLVGSE 174
               WNRAAPNTIPTAAKAGGNYLSSLLVGSE
 Sbjct:    147 WNRAAPNTIPTAAKAGGNYLSSLLVGSE 174

>PDB3P4N7 (Closest domain: ILVE_ECO57 241-296) Number of domains in family: 1063 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO ACID PYRIDOXAL PHOSPHATE FULL=BRANCHED-CHAIN EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID Length = 56 Score = 290 (116.3 bits), Expect = 8e-30 Identities = 56/56 (100%), Positives = 56/56 (100%), Gaps = 1/56 (1%)
 Query:    241 VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGE 296
               VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGE
 Sbjct:    241 VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGE 296

>PDB0N1W7 (Closest domain: D7XDF5_ECOLX 173-226) Number of domains in family: 118 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO ACID FULL=BRANCHED-CHAIN PHOSPHATE PYRIDOXAL IV CLASS Length = 54 Score = 282 (113.2 bits), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%), Gaps = 1/54 (1%)
 Query:    173 SEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAI 226
               SEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAI
 Sbjct:    173 SEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAI 226

>PD588630 (Closest domain: D9PYT4_METTM 94-186) Number of domains in family: 313 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN FULL=BRANCHED-CHAIN-AMINO-ACID Length = 93 Score = 270 (108.6 bits), Expect = 2e-26 Identities = 56/93 (60%), Positives = 65/93 (69%), Gaps = 1/93 (1%)
 Query:     95 AYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNT 154
                YIRP+++ G   MGVNP      +V IAA+ WGAYLGAEALE G+D  VS+W R APNT
 Sbjct:     95 CYIRPVVYRGYGEMGVNP-VNCPVEVAIAAWEWGAYLGAEALEVGVDVGVSTWRRMAPNT 153

 Query:    155 IPTAAKAGGNYLSSLLVGSEARRHGYQEGIALD 187
               +P  AKAGGNYL+S L   EA RHGY E I LD
 Sbjct:    154 MPNLAKAGGNYLNSQLAKMEAVRHGYDEAIMLD 186

>PDC0U2V8 (Closest domain: C4U248_YERKR 47-96) Number of domains in family: 9 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID Length = 50 Score = 259 (104.4 bits), Expect = 2e-25 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 4/50 (8%)
 Query:     48 GPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYI 97
               GPVVFRHREHMQRLHDSAKIYR PVSQ++DELMEACR+ +RKNNLTSAYI
 Sbjct:     47 GPVVFRHREHMQRLHDSAKIYRMPVSQTVDELMEACRETLRKNNLTSAYI 96

>PDC7X3B0 (Closest domain: D4GZV8_HALVD 66-170) Number of domains in family: 6 Commentary (automatic): SUBNAME: AMINOTRANSFERASE LYASE TRANSFERASE EC=2.6.1.42 FULL=BRANCHED-CHAIN AMINO PHOSPHATE PYRIDOXAL FULL=PUTATIVE Length = 105 Score = 251 (101.3 bits), Expect = 9e-24 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 1/106 (0%)
 Query:     64 SAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIA 123
               SAK Y   +  + +EL EA  +VIR+N+L   YIRP+ F G   +GV+P     T+V IA
 Sbjct:     66 SAKPYDMEIPYTREELTEATLEVIRRNDLDGGYIRPIAFYGYDSLGVSPKDN-PTEVAIA 124

 Query:    124 AFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSL 169
               A+PWG YLG +ALE G+D MVSSW + A + IPT AK  G Y++S+
 Sbjct:    125 AWPWGTYLGEDALENGVDVMVSSWRKHASSQIPTNAKTTGLYVNSM 170

>PDB1D788 (Closest domain: D7XDF5_ECOLX 120-168) Number of domains in family: 131 Commentary (automatic): AMINOTRANSFERASE SUBNAME: AMINO TRANSFERASE ACID PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN EC=2.6.1.42 BIOSYNTHESIS Length = 49 Score = 251 (101.3 bits), Expect = 2e-24 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 1/49 (2%)
 Query:    120 VIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSS 168
               VIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSS
 Sbjct:    120 VIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSS 168

>PD713539 (Closest domain: ILVE_ECO57 8-47) Number of domains in family: 1171 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PYRIDOXAL PHOSPHATE ACID AMINO FULL=BRANCHED-CHAIN EC=2.6.1.42 EC=2.6.1.21 Length = 40 Score = 235 (95.1 bits), Expect = 4e-22 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 4/40 (10%)
 Query:      8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK 47
               YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK
 Sbjct:      8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK 47

>PDB05295 (Closest domain: Q8GQE0_LEPIR 189-266) Number of domains in family: 649 Commentary (automatic): SUBNAME: AMINOTRANSFERASE TRANSFERASE LYASE FULL=PARA-AMINOBENZOATE I COMPONENT FULL=PUTATIVE IV CLASS Length = 78 Score = 214 (87.0 bits), Expect = 6e-19 Identities = 41/78 (52%), Positives = 57/78 (73%), Gaps = 4/78 (5%)
 Query:    179 GYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVR 238
               G+ E I LD  G++SEG+ EN+F V+DG + TP   SS L GITR +++++AK+ GIEV 
 Sbjct:    189 GFDEAIFLDSRGFVSEGSAENIFLVRDGKIITPGINSSLLEGITRRSVLQIAKDNGIEVI 248

 Query:    239 EQVLSRESLYLADEVFMS 256
               E+ +SR  LY+ADEVF S
 Sbjct:    249 ERDISRSELYIADEVFFS 266

>PDC678C1 (Closest domain: C8TYT5_ECO10 135-176) Number of domains in family: 81 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID Length = 42 Score = 211 (85.9 bits), Expect = 6e-19 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 4/42 (9%)
 Query:    135 ALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEAR 176
               ALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEAR
 Sbjct:    135 ALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEAR 176

>PDC6Z242 (Closest domain: E3HJN5_ACHXA 8-79) Number of domains in family: 14 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE EC=2.6.1.42 PHOSPHATE PYRIDOXAL AMINO ACID FULL=BRANCHED-CHAIN FULL=BRANCHED-CHAIN-AMINO-ACID Length = 72 Score = 197 (80.5 bits), Expect = 1e-16 Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 1/65 (1%)
 Query:      8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKI 67
               +IW++G++V W DA  HV++H+LHYG SVFEG+R Y S  G  +FR  +H  RL +SA I
 Sbjct:      9 FIWYDGKLVPWRDATTHVLTHSLHYGLSVFEGVRAYRSEIGTAIFRLEDHTNRLFNSAHI 68

 Query:     68 YRFPV 72
               Y+ P+
 Sbjct:     69 YQIPM 73

>PDC8U9P2 (Closest domain: E0TDR9_PARBH 239-303) Number of domains in family: 4 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE EC=2.6.1.42 FULL=PUTATIVE FULL=BRANCHED-CHAIN-AMINO-ACID FULL=BRANCHED-CHAIN AMINO BRANCHED-CHAIN-AMINO-ACID REFERENCE Length = 65 Score = 190 (77.8 bits), Expect = 1e-15 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 3/65 (4%)
 Query:    240 QVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEG---RCGPVTKRIQQAFFGLFTGE 296
               Q + RE LY ADE+F +GTAAEITP+  VDG+ VG        P+T  +Q+AFFGLFTGE
 Sbjct:    239 QEMPRELLYGADELFFTGTAAEITPINRVDGLPVGPASGENARPITGALQKAFFGLFTGE 298

 Query:    297 TEDKW 301
               T DKW
 Sbjct:    299 TSDKW 303

>PDA1F7G3 (Closest domain: F2FS79_SALGL 203-238) Number of domains in family: 1331 Commentary (automatic): AMINOTRANSFERASE TRANSFERASE SUBNAME: AMINO ACID PYRIDOXAL PHOSPHATE FULL=BRANCHED-CHAIN EC=2.6.1.42 BIOSYNTHESIS Length = 36 Score = 186 (76.3 bits), Expect = 2e-15 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 1/36 (2%)
 Query:    203 VKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVR 238
               VKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVR
 Sbjct:    203 VKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVR 238

>PDD2K2V3 (Closest domain: C8WKR3_EGGLE 119-198) Number of domains in family: 2 Commentary (automatic): AMINOTRANSFERASE SUBNAME: FULL=BRANCHED-CHAIN AMINO LYASE TRANSFERASE ACID AMINOTRANSFERASE/4-AMINO-4-DEOXYCHORISMATE PHOSPHATE PYRIDOXAL Length = 80 Score = 183 (75.1 bits), Expect = 1e-14 Identities = 37/78 (47%), Positives = 49/78 (62%), Gaps = 1/78 (1%)
 Query:    118 TDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARR 177
               TDV IA +PW  YLG  AL+ G+   VSSW +   N+IP A KA  +Y++S+L   EA+ 
 Sbjct:    120 TDVAIAVWPWDTYLGDGALDNGVAVGVSSWRQRTNNSIPPAVKATASYMNSILAKLEAKE 179

 Query:    178 HGYQEGIALDVNGYISEG 195
               HGY E I L+  G + EG
 Sbjct:    180 HGYVEAIMLNEAGLVCEG 197

>PD104370 (Closest domain: Q47AV7_DECAR 222-287) Number of domains in family: 846 Commentary (automatic): AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE SUBNAME: LYASE EC=2.6.1.21 FULL=D-ALANINE RECNAME: ACID Length = 66 Score = 180 (73.9 bits), Expect = 3e-14 Identities = 32/65 (49%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Query:    223 RDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVT 282
               R  +I+LA E+G+EV E+ ++R+ +Y ADE F +GTAAE+TP+R +D  Q+G G  GP+T
 Sbjct:    222 RATVIQLASEMGVEVIEKRITRDEVYCADEAFFTGTAAEVTPIRELDNRQIGVGHRGPIT 281

 Query:    283 KRIQQ 287
               K +Q+
 Sbjct:    282 KALQE 286

>PD987952 (Closest domain: Q2FR97_METHJ 133-209) Number of domains in family: 652 Commentary (automatic): LYASE SUBNAME: PYRIDOXAL PHOSPHATE AMINOTRANSFERASE FULL=AMINODEOXYCHORISMATE FULL=4-AMINO-4-DEOXYCHORISMATE TRANSFERASE EC=4.1.3.38 AMINO Length = 77 Score = 158 (65.5 bits), Expect = 4e-11 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Query:    137 EQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGA 196
               E+G+ A+  S  R     +P   K+  NYL+++L   EA   G  E I  D NGY+SEG+
 Sbjct:    135 EKGLKAVTVSVRRNPAEALPPNVKSL-NYLNNILAKIEANCKGGDEAIFFDTNGYVSEGS 193

 Query:    197 GENLFEVKDGVLFTPP 212
               G+N+F +K+GV+ TPP
 Sbjct:    194 GDNIFVIKNGVIITPP 209

>PDA44804 (Closest domain: ILVE_RICFE 51-126) Number of domains in family: 18 Commentary (automatic): AMINOTRANSFERASE AMINO PHOSPHATE PYRIDOXAL ACID SUBNAME: TRANSFERASE FULL=BRANCHED-CHAIN EC=2.6.1.42 BIOSYNTHESIS Length = 76 Score = 156 (64.7 bits), Expect = 8e-11 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Query:     51 VFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGV 110
               VF+ +EH +RL  SA+     V  S+DE+++A   VI++NN+  AYIRPLI+ GD  + +
 Sbjct:     51 VFKLKEHTERLIKSAEALGLKVPYSVDEIIKAHELVIKQNNIKDAYIRPLIWCGDESLNI 110

 Query:    111 NPPAGYSTDVIIAAFP 126
                 P   ST+++IA  P
 Sbjct:    111 TNP-DLSTNLLIAGIP 125

>PDC645W6 (Closest domain: E1RVR2_ECOUM 133-163) Number of domains in family: 231 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 AMINO-ACID Length = 31 Score = 156 (64.7 bits), Expect = 4e-11 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 1/31 (3%)
 Query:    133 AEALEQGIDAMVSSWNRAAPNTIPTAAKAGG 163
               AEALEQGIDAMVSSWNRAAPNTIPTAAKAGG
 Sbjct:    133 AEALEQGIDAMVSSWNRAAPNTIPTAAKAGG 163

>PDC6K8L3 (Closest domain: E0UQN4_SULAO 8-51) Number of domains in family: 25 Commentary (automatic): AMINOTRANSFERASE TRANSFERASE SUBNAME: AMINO ACID PHOSPHATE PYRIDOXAL EC=2.6.1.42 FULL=BRANCHED-CHAIN BIOSYNTHESIS Length = 44 Score = 147 (61.2 bits), Expect = 9e-10 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 2/44 (4%)
 Query:     10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFR 53
               W NG+ V W+DAKVHV++H +HYG  V EG + Y + KG  +FR
 Sbjct:      8 WMNGKFVAWDDAKVHVLTHTIHYGNGVIEGTKAYKTDKGYAIFR 51

>PDD0Y1D8 (Closest domain: B0SS02_LEPBP 232-299) Number of domains in family: 2 Commentary (automatic): SUBNAME: AMINOTRANSFERASE EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID PHOSPHATE TRANSFERASE PYRIDOXAL FULL=PUTATIVE UNCHARACTERIZED Length = 68 Score = 146 (60.8 bits), Expect = 2e-09 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Query:    233 LGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGL 292
               LG +V E+ ++R  LY+ADE+F SGT  ++  V+ VD   +G G  GPVTK+IQ  FF  
 Sbjct:    232 LGYQVIERDIARSELYIADELFFSGTGVQVAWVKEVDRRVIGNGTIGPVTKKIQSIFFET 291

 Query:    293 FTGE 296
                 GE
 Sbjct:    292 VRGE 295

>PDC648L5 (Closest domain: C8UJF3_ECO1A 55-79) Number of domains in family: 197 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO ACID FULL=BRANCHED-CHAIN PYRIDOXAL PHOSPHATE EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID Length = 25 Score = 140 (58.5 bits), Expect = 8e-09 Identities = 25/25 (100%), Positives = 25/25 (100%), Gaps = 1/25 (4%)
 Query:     55 REHMQRLHDSAKIYRFPVSQSIDEL 79
               REHMQRLHDSAKIYRFPVSQSIDEL
 Sbjct:     55 REHMQRLHDSAKIYRFPVSQSIDEL 79

>PDC650B3 (Closest domain: D7Z1R3_ECOLX 175-200) Number of domains in family: 180 Commentary (automatic): SUBNAME: AMINOTRANSFERASE TRANSFERASE AMINO ACID FULL=BRANCHED-CHAIN PHOSPHATE PYRIDOXAL FULL=PUTATIVE UNCHARACTERIZED Length = 26 Score = 134 (56.2 bits), Expect = 6e-08 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 5/26 (19%)
 Query:    175 ARRHGYQEGIALDVNGYISEGAGENL 200
               ARRHGYQEGIALDVNGYISEGAGENL
 Sbjct:    175 ARRHGYQEGIALDVNGYISEGAGENL 200

>PDD123A8 (Closest domain: F8D9Y9_HALXS 248-291) Number of domains in family: 2 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE EC=2.6.1.42 FULL=AMINOTRANSFERASE FULL=BRANCHED-CHAIN AMINO IV ACID CLASS Length = 44 Score = 133 (55.8 bits), Expect = 7e-08 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Query:    247 LYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAF 289
               L+ ADE+F +G+AAE+TP+R VD + VG+G  GP+T+ IQ  F
 Sbjct:    249 LHTADELFFTGSAAEVTPIRKVDNVVVGDGSRGPITEDIQSTF 291

>PDB800A1 (Closest domain: E8X219_ACISM 222-266) Number of domains in family: 8 Commentary (automatic): AMINOTRANSFERASE SUBNAME: AMINO TRANSFERASE ACID CHAIN FULL=BRANCHED-CHAIN FULL=BRANCHED EC=2.6.1.- 2-KETO-4-METHYLTHIOBUTYRATE Length = 45 Score = 133 (55.8 bits), Expect = 8e-08 Identities = 26/44 (59%), Positives = 35/44 (79%), Gaps = 1/44 (2%)
 Query:    226 IIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVD 269
               I+ LAK+LGI+V E  + RE +Y+ADE F +GTAAE+T +RSVD
 Sbjct:    222 ILTLAKDLGIDVVEAPIPREFIYIADEAFFTGTAAEVTHLRSVD 265

>PDC647W4 (Closest domain: B0SS02_LEPBP 181-226) Number of domains in family: 204 Commentary (automatic): LYASE SUBNAME: PHOSPHATE PYRIDOXAL AMINOTRANSFERASE FULL=4-AMINO-4-DEOXYCHORISMATE TRANSFERASE FULL=AMINOTRANSFERASE IV CLASS Length = 46 Score = 133 (55.8 bits), Expect = 9e-08 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 5/46 (10%)
 Query:    182 EGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAII 227
               E I LD  G++SEG+ ENLF V+DGV+ TP   SS L GITR +II
 Sbjct:    181 EAIFLDARGFVSEGSAENLFIVRDGVIHTPTIPSSILEGITRRSII 226

>PD811239 (Closest domain: E4P2X9_ECO8N 107-130) Number of domains in family: 321 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 AMINO-ACID Length = 24 Score = 128 (53.9 bits), Expect = 4e-07 Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 5/24 (20%)
 Query:    107 GMGVNPPAGYSTDVIIAAFPWGAY 130
               GMGVNPPAGYSTDVIIAAFPWGAY
 Sbjct:    107 GMGVNPPAGYSTDVIIAAFPWGAY 130

>PD001961 (Closest domain: ILVE_ECO57 178-201) Number of domains in family: 391 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO ACID FULL=BRANCHED-CHAIN PYRIDOXAL PHOSPHATE EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID Length = 24 Score = 126 (53.1 bits), Expect = 7e-07 Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 1/24 (4%)
 Query:    178 HGYQEGIALDVNGYISEGAGENLF 201
               HGYQEGIALDVNGYISEGAGENLF
 Sbjct:    178 HGYQEGIALDVNGYISEGAGENLF 201

>PD330724 (Closest domain: D9NW06_STRPN 16-111) Number of domains in family: 1183 Commentary (automatic): AMINOTRANSFERASE BIOSYNTHESIS TRANSFERASE EC=2.6.1.42 AMINO ACID FULL=BRANCHED-CHAIN-AMINO-ACID RECNAME: PYRIDOXAL PHOSPHATE Length = 96 Score = 124 (52.4 bits), Expect = 3e-06 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 6/84 (7%)
 Query:     10 WFNGEMVRWEDAKVHVM--SHALHYGTSVFEGIRCYDSHKGPV-VFRHREHMQRLHDSAK 66
               W  GE+   EDA +H+   S +LHYG   FEG++ Y +  G V +FR  E+ +RL  +  
 Sbjct:     30 WDQGELT--EDATLHISESSPSLHYGQQAFEGLKAYRTKDGSVQLFRPDENAKRLQRTCD 87

 Query:     67 IYRFPVSQSIDELMEACRDVIRKN 90
                   P   + D  +EAC+ V+R N
 Sbjct:     88 RLLMPQVPT-DMFVEACKAVVRAN 110

>PDC5L4W2 (Closest domain: A8I7X6_CHLRE 249-315) Number of domains in family: 81 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE LYASE ACID AMINO FULL=4-AMINO-4-DEOXYCHORISMATE FULL=PUTATIVE FULL=BRANCHED-CHAIN FULL=AMINO Length = 67 Score = 123 (52.0 bits), Expect = 3e-06 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 2/64 (3%)
 Query:    173 SEARRHGYQEGIALDV--NGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLA 230
               ++AR  G  + I LD   + Y+ EG+G N+F     VL TPP   S LPGITR ++++LA
 Sbjct:    249 AQARAQGCTDCIYLDARSDTYLEEGSGCNVFATHGRVLTTPPAAGSILPGITRASLLQLA 308

 Query:    231 KELG 234
                 LG
 Sbjct:    309 GALG 312

>PDC9G6H1 (Closest domain: F0S3D8_DESTD 103-154) Number of domains in family: 3 Commentary (automatic): SUBNAME: FULL=AMINOTRANSFERASE AMINOTRANSFERASE LYASE TRANSFERASE IV CLASS 4-AMINO-4-DEOXYCHORISMATE FULL=PUTATIVE Length = 52 Score = 118 (50.1 bits), Expect = 1e-05 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Query:    166 LSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTP 211
               + S+    EAR+ G  E +  D+NG+ISE A  N+F VKDGV FTP
 Sbjct:    108 MDSIYAIEEARKLGGDEALLFDINGFISETAFANIFFVKDGVFFTP 153

>PDB0Q9O6 (Closest domain: G7JT00_MEDTR 235-292) Number of domains in family: 30 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE AMINO ACID IV CLASS FULL=BRANCHED-CHAIN FULL=AMINOTRANSFERASE EC=2.6.1.42 Length = 58 Score = 118 (50.1 bits), Expect = 1e-05 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)
 Query:    191 YISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRE 245
               YI E +  N F VK  VL T P   + LPG+TR ++I+LA++LG EV E+ +S E
 Sbjct:    237 YIEEVSSCNAFIVKGKVLSTAPTLGTILPGVTRKSVIELARDLGYEVMERKVSVE 291

>PDC6E0A7 (Closest domain: B2NTS9_ECO57 1-20) Number of domains in family: 39 Commentary (automatic): AMINOTRANSFERASE SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE EC=2.6.1.42 FULL=BRANCHED-CHAIN FULL=BRANCHED-CHAIN-AMINO-ACID AMINO ACID Length = 20 Score = 117 (49.7 bits), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 2/20 (10%)
 Query:      1 MTTKKADYIWFNGEMVRWED 20
               MTTKKADYIWFNGEMVRWED
 Sbjct:      1 MTTKKADYIWFNGEMVRWED 20

>PDA2O226 (Closest domain: Q887G4_PSESM 167-227) Number of domains in family: 877 Commentary (automatic): AMINOTRANSFERASE BIOSYNTHESIS TRANSFERASE AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID RECNAME: PHOSPHATE PYRIDOXAL Length = 61 Score = 115 (48.9 bits), Expect = 4e-05 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 3/61 (4%)
 Query:    143 MVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALD--VNGYISEGAGENL 200
               ++S ++RAAPN    AAK GGNY +SL+ GSEA++H + + I LD   +  I E    N 
 Sbjct:    168 VISGYDRAAPNGT-GAAKVGGNYAASLMPGSEAKKHSFADCIYLDPQTHSKIEEVGSANF 226

 Query:    201 F 201
               F
 Sbjct:    227 F 227

>PDB068E5 (Closest domain: G8SL40_ACTS5 235-276) Number of domains in family: 698 Commentary (automatic): AMINOTRANSFERASE BIOSYNTHESIS AMINO ACID TRANSFERASE EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID RECNAME: BRANCHED-CHAIN AMINO-ACID Length = 42 Score = 115 (48.9 bits), Expect = 2e-05 Identities = 23/40 (57%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Query:    191 YISEGAGENLFEV-KDGVLFTPPFTSSALPGITRDAIIKL 229
               YI E  G N+F V  DG L TPP T + LPGITRD++I+L
 Sbjct:    237 YIDELGGMNVFLVLDDGTLVTPPLTGTILPGITRDSVIRL 276

>PDC6B437 (Closest domain: E8Q6J8_BLOVB 262-295) Number of domains in family: 50 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL AMINO ACID FULL=BRANCHED-CHAIN EC=2.6.1.42 AMIOTRANSFERASE Length = 34 Score = 115 (48.9 bits), Expect = 2e-05 Identities = 21/34 (61%), Positives = 28/34 (82%), Gaps = 1/34 (2%)
 Query:    263 TPVRSVDGIQVGEGRC-GPVTKRIQQAFFGLFTG 295
               TPVRS+DGI++G G   GP+T ++Q+ FFGLFTG
 Sbjct:    262 TPVRSIDGIKIGSGGVKGPITMKLQELFFGLFTG 295

>PD924485 (Closest domain: D2TH76_CITRI 164-185) Number of domains in family: 272 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL FULL=BRANCHED-CHAIN AMINO ACID EC=2.6.1.42 AMINO-ACID Length = 22 Score = 111 (47.4 bits), Expect = 7e-05 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 7/22 (31%)
 Query:    164 NYLSSLLVGSEARRHGYQEGIA 185
               NYLSSLLVGSEARRHGYQEGIA
 Sbjct:    164 NYLSSLLVGSEARRHGYQEGIA 185

>PDB0U9Y7 (Closest domain: E1QWI4_OLSUV 279-341) Number of domains in family: 438 Commentary (automatic): AMINOTRANSFERASE BIOSYNTHESIS TRANSFERASE AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID BRANCHED-CHAIN AMINO-ACID RECNAME: Length = 63 Score = 110 (47.0 bits), Expect = 0.0002 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 4/61 (6%)
 Query:    252 EVFMSGTAAEITPVRSVDG----IQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQV 307
               E  M GTAA I+PV  VD     +  G    GPV +R+++   G+ +GE ED++GW+ ++
 Sbjct:    281 ECGMCGTAAVISPVGEVDAADKQVVYGMDHVGPVMQRLRETLTGIQSGEIEDRFGWVHKI 340

 Query:    308 N 308
               +
 Sbjct:    341 D 341

>PDD1F816 (Closest domain: Q096N4_STIAD 113-171) Number of domains in family: 2 Commentary (automatic): AMINOTRANSFERASE SUBNAME: FULL=BRANCHED-CHAIN AMINO TRANSFERASE ACID Length = 59 Score = 108 (46.2 bits), Expect = 0.0002 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Query:    165 YLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGIT 222
               YL S++   E  R G  EG+ L V G++  G   N+F V    L TP   S  LPGIT
 Sbjct:    114 YLPSIIARQELDRDGMVEGVQLAVAGHVVSGLVSNIFAVSGRRLLTPDLASGCLPGIT 171

>PDB320H7 (Closest domain: F8FPM3_PAEMK 229-266) Number of domains in family: 254 Commentary (automatic): AMINOTRANSFERASE SUBNAME: TRANSFERASE EC=2.6.1.21 FULL=D-ALANINE IV CLASS FULL=AMINOTRANSFERASE PHOSPHATE PYRIDOXAL Length = 38 Score = 102 (43.9 bits), Expect = 0.001 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Query:    243 SRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGP 280
               + + L  ADEVF++GT  E+TPV SVDG+ V  G+ GP
 Sbjct:    229 TLDELQAADEVFITGTTVEVTPVVSVDGLPVSGGQPGP 266

>PDB126G4 (Closest domain: C5UPW6_CLOBO 148-190) Number of domains in family: 71 Commentary (automatic): SUBNAME: AMINOTRANSFERASE TRANSFERASE PHOSPHATE PYRIDOXAL IV CLASS FULL=PUTATIVE UNCHARACTERIZED FULL=AMINOTRANSFERASE Length = 43 Score = 101 (43.5 bits), Expect = 0.002 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Query:    182 EGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPG 220
               E I +D NGYI+EG+  N+F +KD +L T P   + LPG
 Sbjct:    153 EAILVDRNGYITEGSKSNIFMIKDNILLTSP-VKAVLPG 190

>PDB5T5X6 (Closest domain: D4GZV8_HALVD 7-36) Number of domains in family: 12 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED AMINOTRANSFERASE EC=2.6.1.42 FULL=BRANCHED-CHAIN PRECURSOR RFS2 AMINO REFERENCE Length = 30 Score = 99 (42.7 bits), Expect = 0.003 Identities = 17/26 (65%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Query:      9 IWFNGEMVRWEDAKVHVMSHALHYGT 34
               IW +GE   WEDA VHV++H LHYGT
 Sbjct:     11 IWQSGEYKDWEDATVHVLTHGLHYGT 36

>PDA08133 (Closest domain: E0UID2_CYAP2 2-62) Number of domains in family: 23 Commentary (automatic): SUBNAME: LYASE AMINOTRANSFERASE TRANSFERASE IV CLASS FULL=AMINOTRANSFERASE PHOSPHATE PYRIDOXAL FULL=PUTATIVE Length = 61 Score = 98 (42.4 bits), Expect = 0.006 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 6/59 (10%)
 Query:     10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIY 68
               W+NGE+V  E   +++    L YG +VF  +R YD      +   + H  RLH S +++
 Sbjct:      3 WYNGELVDGESLCLNITDPGLIYGATVFTTLRVYDQSLDHPLTHWQSHCDRLHRSIEVF 61

>PDC640Y7 (Closest domain: F7YHR6_VIBA7 261-289) Number of domains in family: 355 Commentary (automatic): AMINOTRANSFERASE TRANSFERASE EC=2.6.1.21 FULL=D-ALANINE PYRIDOXAL PHOSPHATE RECNAME: SUBNAME: IV CLASS Length = 29 Score = 98 (42.4 bits), Expect = 0.004 Identities = 19/29 (65%), Positives = 24/29 (82%), Gaps = 8/29 (27%)
 Query:    261 EITPVRSVDGIQVGEGRCGPVTKRIQQAF 289
               EI PVRSVD I VGEG+ GP+TK +Q+A+
 Sbjct:    261 EIVPVRSVDQITVGEGKRGPITKVMQEAY 289

>PDC643C1 (Closest domain: F2LKR4_BURGS 326-363) Number of domains in family: 280 Commentary (automatic): AMINOTRANSFERASE BIOSYNTHESIS TRANSFERASE AMINO ACID EC=2.6.1.42 FULL=BRANCHED-CHAIN-AMINO-ACID BRANCHED-CHAIN PHOSPHATE PYRIDOXAL Length = 38 Score = 96 (41.6 bits), Expect = 0.008 Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 5/33 (15%)
 Query:    273 VGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLD 305
               +G+G+ GPVT+R++Q+  G+ TG   D+ GW+D
 Sbjct:    331 IGDGKAGPVTQRLKQSLVGIQTGREADQHGWVD 363

>PDC6R9T9 (Closest domain: G0BC53_SERSA 1-20) Number of domains in family: 18 Commentary (automatic): AMINOTRANSFERASE SUBNAME: PHOSPHATE TRANSFERASE PYRIDOXAL EC=2.6.1.42 FULL=BRANCHED-CHAIN AMINO ACID FULL=BRANCHED-CHAIN-AMINO-ACID Length = 20 Score = 96 (41.6 bits), Expect = 0.008 Identities = 17/19 (89%), Positives = 17/19 (89%), Gaps = 2/19 (10%)
 Query:      3 TKKADYIWFNGEMVRWEDA 21
               TKKADYIWFNGEMV W DA
 Sbjct:      2 TKKADYIWFNGEMVPWADA 20