Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD808637 score=247 PDB6P933 score=246 PDC67453 score=105 PD479864 score=284 PD518983 score=111 PD348124 score=202 PDC64225 score=211 PD518983 score=111 PDB084S6 score=123 PDA1F6W9 score=173 PD003226 score=166 PDA243P2 score=149 PDA148T2 score=152


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD479864
PD808637
PDB6P933
PDC64225
PD348124
PDB082A7
PDC664C4
PDA1F6W9
PD003226
PDA148T2
PDA243P2
PDA722M3
PD135366
PDB084S6
PDB588D7
PD518983
PDC67453
PDD2V7Z4
PDA1G239
PDB374K1

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD479864
PD808637
PDC64225
PD348124
PDB082A7
PDA1F6W9
PD003226
PDA148T2
PD135366
PDB084S6
PDA1G239

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD479864
PD808637
PDC64225
PD348124
PDB082A7
PDA1F6W9
PD003226
PDA148T2
PD135366
PDB084S6
PDA1G239


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(402 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      5-53  #PD808637                                            247 2e-23
      5-43  #PDC664C4                                            194 5e-16
      7-92  #PDA722M3                                            133 3e-07
      7-90  #PDB588D7                                            118 3e-05
     8-117  #PDD2V7Z4                                            103 0.004
     45-92  #PDB6P933                                            246 3e-23
     53-91  #PDB082A7                                            200 8e-17
    70-118  #PDB374K1                                            100 0.008
    71-114  #PDC67453                                            105 0.0009
    94-147  #PD479864                                            284 2e-28
   141-240  #PD518983                                            111 0.0003
   149-181  #PD348124                                            202 3e-17
   152-186  #PDC64225                                            211 2e-18
   203-222  #PDA1G239                                            103 0.002
   223-245  #PDB084S6                                            123 3e-06
   249-297  #PDA1F6W9                                            173 6e-13
   314-347  #PD003226                                            166 6e-12
   318-390  #PDA243P2                                            149 2e-09
   364-389  #PD135366                                            129 5e-07
   365-394  #PDA148T2                                            152 3e-10


>PD479864 (Closest domain: C6UU03_ECO5T 94-147)
Number of domains in family: 2496
Commentary (automatic):
KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE CYTOPLASM EC=2.7.2.1 ALTNAME: FULL=ACETOKINASE  
Length = 54
Score = 284  (114.0 bits), Expect = 2e-28
Identities = 54/54 (100%), Positives = 54/54 (100%)

 Query:     94 FTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFH 147
               FTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFH
 Sbjct:     94 FTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFH 147

>PD808637 (Closest domain: D6I1A1_ECOLX 5-53) Number of domains in family: 2056 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE EC=2.7.2.1 CYTOPLASM ALTNAME: FULL=ACETOKINASE Length = 49 Score = 247 (99.8 bits), Expect = 2e-23 Identities = 49/49 (100%), Positives = 49/49 (100%)
 Query:      5 PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPA 53
               PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPA
 Sbjct:      5 PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPA 53

>PDB6P933 (Closest domain: D8AJS8_ECOLX 49-96) Number of domains in family: 110 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE CYTOPLASM EC=2.7.2.1 ALTNAME: FULL=ACETOKINASE Length = 48 Score = 246 (99.4 bits), Expect = 3e-23 Identities = 48/48 (100%), Positives = 48/48 (100%)
 Query:     45 LSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGGS 92
               LSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGGS
 Sbjct:     49 LSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGGS 96

>PDC64225 (Closest domain: B3X2Y6_SHIDY 156-190) Number of domains in family: 314 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING FULL=ACETATE CYTOPLASM EC=2.7.2.1 RECNAME: ALTNAME: FULL=ACETOKINASE Length = 35 Score = 211 (85.9 bits), Expect = 2e-18 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Query:    152 PEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRA 186
               PEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRA
 Sbjct:    156 PEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRA 190

>PD348124 (Closest domain: H0QEE0_ECOLI 149-181) Number of domains in family: 2052 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE CYTOPLASM EC=2.7.2.1 ALTNAME: FULL=ACETOKINASE Length = 33 Score = 202 (82.4 bits), Expect = 3e-17 Identities = 33/33 (100%), Positives = 33/33 (100%)
 Query:    149 TMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRY 181
               TMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRY
 Sbjct:    149 TMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRY 181

>PDB082A7 (Closest domain: D2A839_SHIF2 57-95) Number of domains in family: 1997 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE EC=2.7.2.1 CYTOPLASM ALTNAME: FULL=ACETOKINASE Length = 39 Score = 200 (81.6 bits), Expect = 8e-17 Identities = 39/39 (100%), Positives = 39/39 (100%)
 Query:     53 APLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGG 91
               APLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGG
 Sbjct:     57 APLAHHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGG 95

>PDC664C4 (Closest domain: D8AJS8_ECOLX 9-47) Number of domains in family: 109 Commentary (automatic): KINASE TRANSFERASE FULL=ACETATE NUCLEOTIDE-BINDING EC=2.7.2.1 ATP-BINDING CYTOPLASM ALTNAME: FULL=ACETOKINASE RECNAME: Length = 39 Score = 194 (79.3 bits), Expect = 5e-16 Identities = 39/39 (100%), Positives = 39/39 (100%)
 Query:      5 PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENA 43
               PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENA
 Sbjct:      9 PVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENA 47

>PDA1F6W9 (Closest domain: D6I1A1_ECOLX 249-297) Number of domains in family: 2117 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE CYTOPLASM EC=2.7.2.1 FULL=ACETOKINASE ALTNAME: Length = 49 Score = 173 (71.2 bits), Expect = 6e-13 Identities = 36/49 (73%), Positives = 36/49 (73%)
 Query:    249 ASQTNQSLGDLERVVNKEXXXXXXXXXXXXXRVLEKAWHEGHERAQLAI 297
               ASQTNQSLGDLERVVNKE             RVLEKAWHEGHERAQLAI
 Sbjct:    249 ASQTNQSLGDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERAQLAI 297

>PD003226 (Closest domain: D6I1A1_ECOLX 300-347) Number of domains in family: 2701 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: CYTOPLASM ALTNAME: FULL=ACETATE EC=2.7.2.1 FULL=ACETOKINASE Length = 48 Score = 166 (68.6 bits), Expect = 6e-12 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Query:    314 SLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGV 347
               SLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGV
 Sbjct:    314 SLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGV 347

>PDA148T2 (Closest domain: D6I1A1_ECOLX 365-394) Number of domains in family: 284 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING FULL=ACETATE CYTOPLASM EC=2.7.2.1 RECNAME: ALTNAME: FULL=ACETOKINASE Length = 30 Score = 152 (63.2 bits), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 2/30 (6%)
 Query:    365 VSSENARVICAVIPTNEEKMIALDAIHLGK 394
               VSSENARVICAVIPTNEEKMIALDAIHLGK
 Sbjct:    365 VSSENARVICAVIPTNEEKMIALDAIHLGK 394

>PDA243P2 (Closest domain: Q13JZ9_BURXL 304-387) Number of domains in family: 47 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING FULL=ACETATE CYTOPLASM EC=2.7.2.1 ALTNAME: FULL=ACETOKINASE RECNAME: Length = 84 Score = 149 (62.0 bits), Expect = 2e-09 Identities = 32/73 (43%), Positives = 51/73 (69%), Gaps = 4/73 (5%)
 Query:    318 LDGIIFTGGIGENSSLIRRLVMEHLAVLGVEIDTEMNNRSNSCGERIVSSENARVICAVI 377
               LD ++FT GIGE+   +R  V E LA LG+E+D + N+ SN+C   ++SS  +++   V+
 Sbjct:    319 LDSLVFTAGIGEHQPAVRLAVCERLAWLGIELDRDAND-SNAC---VISSARSQITVLVL 374

 Query:    378 PTNEEKMIALDAI 390
               PT+EE++IA +AI
 Sbjct:    375 PTDEEQIIANEAI 387

>PDA722M3 (Closest domain: C4LA92_TOLAT 17-109) Number of domains in family: 99 Commentary (automatic): KINASE NUCLEOTIDE-BINDING TRANSFERASE ATP-BINDING CYTOPLASM FULL=ACETATE EC=2.7.2.1 ALTNAME: FULL=ACETOKINASE RECNAME: Length = 93 Score = 133 (55.8 bits), Expect = 3e-07 Identities = 34/93 (36%), Positives = 46/93 (49%), Gaps = 7/93 (7%)
 Query:      7 VLVINCGSSSIKFSVLDASDC----EVLMSGIADGINSENAFLSVNGGEPAPL---AHHS 59
               +LV+NCGSSSIKF+V D S      + L +G   GI   +      G  P P+     H 
 Sbjct:     17 ILVLNCGSSSIKFAVFDPSATPLPRQALWNGKVLGIGGADPDFEETGVAPFPIKLDTAHP 76

 Query:     60 YEGALKAIAFELEKRNLNDSVALIGHRIAHGGS 92
               Y  AL+ I   + +R     +  + HRI HGGS
 Sbjct:     77 YRAALRIIRDRVSQRLDGRRIGAVAHRIVHGGS 109

>PD135366 (Closest domain: E3PK27_ECOH1 368-393) Number of domains in family: 1136 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE EC=2.7.2.1 CYTOPLASM ALTNAME: FULL=ACETOKINASE Length = 26 Score = 129 (54.3 bits), Expect = 5e-07 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 2/26 (7%)
 Query:    364 IVSSENARVICAVIPTNEEKMIALDA 389
               IVSSENARVICAVIPTNEEKMIALDA
 Sbjct:    368 IVSSENARVICAVIPTNEEKMIALDA 393

>PDB084S6 (Closest domain: E4P9S3_ECO8N 223-245) Number of domains in family: 2518 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE CYTOPLASM EC=2.7.2.1 FULL=ACETOKINASE ALTNAME: Length = 23 Score = 123 (52.0 bits), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 2/23 (8%)
 Query:    223 MGMTPLEGLMMGTRSGDVDFGAM 245
               MGMTPLEGLMMGTRSGDVDFGAM
 Sbjct:    223 MGMTPLEGLMMGTRSGDVDFGAM 245

>PDB588D7 (Closest domain: C5B1T4_METEA 8-97) Number of domains in family: 33 Commentary (automatic): KINASE FULL=ACETATE EC=2.7.2.1 TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING CYTOPLASM ALTNAME: FULL=ACETOKINASE RECNAME: Length = 90 Score = 118 (50.1 bits), Expect = 3e-05 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 6/90 (6%)
 Query:      7 VLVINCGSSSIKFSVLD-ASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSYEGALK 65
               +L +N GSSS+KF++ D A     L SG+ +GI S  A L V G E       +      
 Sbjct:      8 ILTVNSGSSSVKFALFDTAGPMTRLWSGVFEGIGSAQARLVVRGDEAVEAQQTALRDHAA 67

 Query:     66 AIAF-----ELEKRNLNDSVALIGHRIAHG 90
               A+AF     E + R    S+  +GHR+ HG
 Sbjct:     68 ALAFILDHTEEQLRRQGVSLRAVGHRVVHG 97

>PD518983 (Closest domain: Q67ND2_SYMTH 103-226) Number of domains in family: 391 Commentary (automatic): KINASE NUCLEOTIDE-BINDING ATP-BINDING TRANSFERASE EC=2.7.2.7 SHORT=BK RECNAME: CYTOPLASM ALTNAME: FULL=BRANCHED-CHAIN Length = 124 Score = 111 (47.4 bits), Expect = 0.0003 Identities = 35/100 (35%), Positives = 48/100 (48%), Gaps = 7/100 (7%)
 Query:    141 VFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRAHSLLNLAEDDSGLV 200
               + D      + P A L GLP         RR  FH  + + V++RA + L  A  +  LV
 Sbjct:    128 IVDPVVVDELEPVARLTGLPEMP------RRSVFHALNQKAVARRAAADLGRAYTEVNLV 181

 Query:    201 VAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDV 240
               V HLG G S+ A R G+ VD +  +   EG M   R+G V
 Sbjct:    182 VVHLGGGISVGAHRRGRVVDVNNALDG-EGPMAPERAGTV 220

>PDC67453 (Closest domain: C3XB72_OXAFO 68-115) Number of domains in family: 87 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING FULL=ACETATE CYTOPLASM EC=2.7.2.1 RECNAME: ALTNAME: FULL=ACETOKINASE Length = 48 Score = 105 (45.1 bits), Expect = 0.0009 Identities = 17/44 (38%), Positives = 32/44 (72%), Gaps = 1/44 (2%)
 Query:     71 LEKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPL 114
               +EK    D ++ +GHR+ HGG+++ E  ++T EV++N+R++ PL
 Sbjct:     72 IEKFLAPDHLSAVGHRMLHGGTLYDEPILVTPEVLENLRKLIPL 115

>PDD2V7Z4 (Closest domain: E8X535_ACISM 1-128) Number of domains in family: 2 Commentary (automatic): KINASE NUCLEOTIDE-BINDING EC=2.7.2.1 TRANSFERASE ATP-BINDING CYTOPLASM FULL=ACETATE SUBNAME: ALTNAME: FULL=ACETOKINASE Length = 128 Score = 103 (44.3 bits), Expect = 0.004 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 14/124 (11%)
 Query:      8 LVINCGSSSIKFSVLDASDCEVLMSGIADGINS------ENAFLSV-NGGEPAPLAHHSY 60
               LV N GS+S+KF V+  +D +         I +      + A LSV +   P  LAH   
 Sbjct:      5 LVFNPGSNSLKFEVVRLTDNQRFAGEATKRITAAIEEFGDEATLSVFDPSRPRQLAHSEK 64

 Query:     61 EGA--LKAIA-FEL----EKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSP 113
                 A  +KA   F L    +++   DS+A    R+ HGG  +  +  +TDEV+ +I  +  
 Sbjct:     65 VKAPDMKAATDFALRWLKDQKVSADSLAFTAVRVVHGGVKYDGATRVTDEVLHDIEALEE 124

 Query:    114 LAPL 117
               LAPL
 Sbjct:    125 LAPL 128

>PDA1G239 (Closest domain: G7SXZ6_SALET 203-222) Number of domains in family: 2200 Commentary (automatic): KINASE TRANSFERASE NUCLEOTIDE-BINDING ATP-BINDING RECNAME: FULL=ACETATE EC=2.7.2.1 CYTOPLASM ALTNAME: FULL=ACETOKINASE Length = 20 Score = 103 (44.3 bits), Expect = 0.002 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 1/20 (5%)
 Query:    203 HLGNGASICAVRNGQSVDTS 222
               HLGNGASICAVRNGQSVDTS
 Sbjct:    203 HLGNGASICAVRNGQSVDTS 222

>PDB374K1 (Closest domain: G2XF98_VERDV 24-132) Number of domains in family: 55 Commentary (automatic): KINASE SUBNAME: FULL=ACETATE FULL=PUTATIVE UNCHARACTERIZED ACETATE TRANSFERASE EC=2.7.2.1 REFERENCE KINASE Length = 109 Score = 100 (43.1 bits), Expect = 0.008 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Query:     70 ELEKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLH 118
               EL++    D + +  HRI HGG  +T S IIT +   ++ ++S LAPLH
 Sbjct:     85 ELKEIQAKDDIGITSHRIVHGGD-YTASQIITPDTYHHLEKLSDLAPLH 132