Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDD131H2 score=233 PD021323 score=298 PD478081 score=246 PDD131H2 score=233 PDA1E5N5 score=185 PD896339 score=168 PDB919Q9 score=100


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD021323
PD478081
PDD131H2
PD002844
PDA1E5N5
PD896339
PDA834Q9
PD002971
PDB3P0Y4
PDC637M9
PDC63904
PDD403N5
PDD673S9
PDD0E4R0
PDC645M8
PDC8J712
PDB3O8Z5
PDB919Q9

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD021323
PD002844
PDA1E5N5
PD896339
PDA834Q9
PD002971
PDB3P0Y4
PDC637M9
PDC63904
PDC645M8

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD021323
PD002844
PDA1E5N5
PD896339
PDA834Q9
PD002971
PDB3P0Y4
PDC637M9
PDC63904
PDC645M8


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(173 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

    11-105  #PDD131H2                                            233 3e-22
     11-53  #PDB3O8Z5                                            100 0.0006
     11-54  #PD002844                                            224 1e-21
     11-83  #PDD403N5                                            128 9e-08
     12-54  #PDC8J712                                            108 4e-05
     14-72  #PD021323                                            298 2e-32
     15-83  #PD478081                                            246 2e-24
     27-82  #PDD0E4R0                                            116 3e-06
     48-97  #PDD673S9                                            117 2e-06
     54-81  #PDB3P0Y4                                            136 4e-09
     55-81  #PDC637M9                                            131 2e-08
    82-109  #PD002971                                            137 3e-09
    83-171  #PDB919Q9                                            100 0.001
    98-169  #PDA1E5N5                                            185 1e-15
   111-135  #PDC63904                                            129 3e-08
   113-134  #PDC645M8                                            115 3e-06
   135-169  #PDA834Q9                                            167 2e-13
   136-170  #PD896339                                            168 2e-13


>PD021323 (Closest domain: F4U3F7_ECOLX 4-62)
Number of domains in family: 680
Commentary (automatic):
SUBNAME: DOMAIN SUBUNIT ACID-BINDING FULL=AMINO ACT SMALL FULL=ACETOLACTATE SYNTHASE FULL=ACT  
Length = 59
Score = 298  (119.4 bits), Expect = 2e-32
Identities = 59/59 (100%), Positives = 59/59 (100%)

 Query:     14 ILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEK 72
               ILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEK
 Sbjct:      4 ILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEK 62

>PD478081 (Closest domain: A4J178_DESRM 5-74) Number of domains in family: 2104 Commentary (automatic): SUBNAME: DEHYDROGENASE OXIDOREDUCTASE FULL=D-3-PHOSPHOGLYCERATE EC=1.1.1.95 SUBUNIT BIOSYNTHESIS FULL=PHOSPHOGLYCERATE FULL=L-SERINE BETA Length = 70 Score = 246 (99.4 bits), Expect = 2e-24 Identities = 46/69 (66%), Positives = 57/69 (82%)
 Query:     15 LSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEKQL 74
               L+VL+EN  G L+RV GLFS+RGYNI+SL V  TDDP +SRMTI   GDE+VLEQ+ KQL
 Sbjct:      5 LAVLVENSPGVLARVAGLFSRRGYNIDSLAVGRTDDPAISRMTIVVEGDERVLEQVSKQL 64

 Query:     75 HKLVDVLRV 83
               HKLVDV+++
 Sbjct:     65 HKLVDVIKI 73

>PDD131H2 (Closest domain: Q5SJ02_THET8 1-100) Number of domains in family: 2 Commentary (automatic): SUBNAME: SMALL FULL=ACETOLACTATE SUBUNIT SYNTHASE REFERENCE ILVN Length = 100 Score = 233 (94.4 bits), Expect = 3e-22 Identities = 44/95 (46%), Positives = 70/95 (73%), Gaps = 1/95 (1%)
 Query:     11 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 70
               MR ++SVL+++    L+R+ GLF++RG+N+ESL V  T  P LSR+ +   GD++ LEQ+
 Sbjct:      1 MRHVISVLVQDHPRVLNRITGLFARRGFNLESLAVGTTHQPGLSRICLVVSGDDRTLEQV 60

 Query:     71 EKQLHKLVDVLRVRELGQGAHVEREIMLVKIQASG 105
               EKQL++L++VL+V +  +  HVERE+ LVK+  +G
 Sbjct:     61 EKQLNRLIEVLKVTDHTE-PHVERELCLVKVHVAG 94

>PD002844 (Closest domain: Q1RGB8_ECOUT 11-54) Number of domains in family: 1321 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE REGULATORY III Length = 44 Score = 224 (90.9 bits), Expect = 1e-21 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 1/44 (2%)
 Query:     11 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS 54
               MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
 Sbjct:     11 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS 54

>PDA1E5N5 (Closest domain: A1KAB6_AZOSB 88-158) Number of domains in family: 790 Commentary (automatic): SUBNAME: SUBUNIT SMALL FULL=ACETOLACTATE SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE FULL=PUTATIVE UNCHARACTERIZED Length = 71 Score = 185 (75.9 bits), Expect = 1e-15 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Query:     98 LVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEV 157
               L+K++A+G  R+E+KR  +IFR +IIDVT + Y ++L G   KLDAF+ +I D A I+E 
 Sbjct:     88 LIKVRATGKDREEMKRTADIFRARIIDVTDASYVIELTGNQSKLDAFIGAI-DPALILET 146

 Query:    158 ARSGVVGLSRGD 169
                RSGV G+ RGD
 Sbjct:    147 VRSGVCGIGRGD 158

>PD896339 (Closest domain: Q0TLR1_ECOL5 126-160) Number of domains in family: 564 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL EC=2.2.1.6 SYNTHASE SYNTHASE TRANSFERASE III ISOZYME Length = 35 Score = 168 (69.3 bits), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 1/35 (2%)
 Query:    136 GTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDK 170
               GTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDK
 Sbjct:    126 GTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDK 160

>PDA834Q9 (Closest domain: D6IJY6_ECOLX 125-159) Number of domains in family: 231 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE REGULATORY ISOZYME Length = 35 Score = 167 (68.9 bits), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 1/35 (2%)
 Query:    135 AGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGD 169
               AGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGD
 Sbjct:    125 AGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGD 159

>PD002971 (Closest domain: Q1RGB8_ECOUT 82-109) Number of domains in family: 963 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE III ISOZYME Length = 28 Score = 137 (57.4 bits), Expect = 3e-09 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 1/28 (3%)
 Query:     82 RVRELGQGAHVEREIMLVKIQASGYGRD 109
               RV ELGQGAHVEREIMLVKIQASGYGRD
 Sbjct:     82 RVSELGQGAHVEREIMLVKIQASGYGRD 109

>PDB3P0Y4 (Closest domain: F4UI48_ECOLX 44-71) Number of domains in family: 278 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL EC=2.2.1.6 TRANSFERASE SYNTHASE SYNTHASE REGULATORY III Length = 28 Score = 136 (57.0 bits), Expect = 4e-09 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 1/28 (3%)
 Query:     54 SRMTIQTVGDEKVLEQIEKQLHKLVDVL 81
               SRMTIQTVGDEKVLEQIEKQLHKLVDVL
 Sbjct:     44 SRMTIQTVGDEKVLEQIEKQLHKLVDVL 71

>PDC637M9 (Closest domain: F5ZUB1_SALTU 45-71) Number of domains in family: 626 Commentary (automatic): SUBNAME: FULL=ACETOLACTATE SUBUNIT SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE III ISOZYME Length = 27 Score = 131 (55.1 bits), Expect = 2e-08 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 1/27 (3%)
 Query:     55 RMTIQTVGDEKVLEQIEKQLHKLVDVL 81
               RMTIQTVGDEKVLEQIEKQLHKLVDVL
 Sbjct:     45 RMTIQTVGDEKVLEQIEKQLHKLVDVL 71

>PDC63904 (Closest domain: Q1RGB8_ECOUT 111-135) Number of domains in family: 465 Commentary (automatic): SUBNAME: FULL=ACETOLACTATE SUBUNIT SMALL SYNTHASE EC=2.2.1.6 TRANSFERASE SYNTHASE III ISOZYME Length = 25 Score = 129 (54.3 bits), Expect = 3e-08 Identities = 25/25 (100%), Positives = 25/25 (100%), Gaps = 1/25 (4%)
 Query:    111 VKRNTEIFRGQIIDVTPSLYTVQLA 135
               VKRNTEIFRGQIIDVTPSLYTVQLA
 Sbjct:    111 VKRNTEIFRGQIIDVTPSLYTVQLA 135

>PDD403N5 (Closest domain: E3H7Y7_ILYPC 1-78) Number of domains in family: 1 Commentary (automatic): SUBNAME: REGULATORY FULL=ACETOLACTATE SYNTHASE SUBUNIT Length = 78 Score = 128 (53.9 bits), Expect = 9e-08 Identities = 31/76 (40%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Query:     11 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPT--DDPTLSRMTIQTV-GDEKVL 67
               M+R L +  +N+    SR+  LF+++GYN+ES+ VA T  +DP   +MT+  V  D+ +L
 Sbjct:      1 MKRELLITAKNKISTHSRIYNLFNKKGYNLESV-VAHTCKEDPENIKMTLAVVKSDQALL 59

 Query:     68 EQIEKQLHKLVDVLRV 83
               EQI+  L+K+VD++ V
 Sbjct:     60 EQIKINLYKIVDIVSV 75

>PDD673S9 (Closest domain: Q2S0N0_SALRD 95-144) Number of domains in family: 1 Commentary (automatic): SUBNAME: SMALL REFERENCE FULL=ACETOLACTATE SYNTHASE SUBUNIT Length = 50 Score = 117 (49.7 bits), Expect = 2e-06 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Query:     48 TDDPTLSRMTIQTVGDEKVLEQIEKQLHKLVDVLRVRELGQGAHVEREIM 97
               TD+P+++R+T+ TVG+++++ QI +QL  LV+   V +L    HVERE+ 
 Sbjct:     95 TDEPSVARLTLVTVGNDRIVAQITRQLDNLVNTYDVTDLTDAEHVERELC 144

>PDD0E4R0 (Closest domain: F8LSB5_STRE8 14-70) Number of domains in family: 2 Commentary (automatic): SUBNAME: SMALL SYNTHASE SUBUNIT ALS AHAS TRANSFERASE FULL=ACETOLACTATE EC=2.2.1.6 FULL=PUTATIVE Length = 57 Score = 116 (49.3 bits), Expect = 3e-06 Identities = 25/57 (43%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Query:     27 SRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQT-VGDEKVLEQIEKQLHKLVDVLR 82
               +R  G+ S+R  NIES++V  ++DP +SR+TI   V  +  +EQI KQL++ +DV+R
 Sbjct:     14 NRFTGVLSRRQVNIESISVGASEDPNVSRITIIIDVNSQNEVEQIIKQLNRQIDVIR 70

>PDC645M8 (Closest domain: D6IJY6_ECOLX 103-124) Number of domains in family: 234 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE REGULATORY ISOZYME Length = 22 Score = 115 (48.9 bits), Expect = 3e-06 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 1/22 (4%)
 Query:    113 RNTEIFRGQIIDVTPSLYTVQL 134
               RNTEIFRGQIIDVTPSLYTVQL
 Sbjct:    103 RNTEIFRGQIIDVTPSLYTVQL 124

>PDC8J712 (Closest domain: D8IAL5_BRAP9 1-48) Number of domains in family: 4 Commentary (automatic): SUBNAME: SMALL FULL=ACETOLACTATE SUBUNIT SYNTHASE FULL=PUTATIVE UNCHARACTERIZED SYNTHASE Length = 48 Score = 108 (46.2 bits), Expect = 4e-05 Identities = 20/43 (46%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Query:     12 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS 54
               RR+L + ++N SG L+R+  LFSQ+G+NIE++T + T  P++S
 Sbjct:      6 RRVLVLFVDNSSGVLNRITLLFSQKGFNIETITCSVTCVPSIS 48

>PDB3O8Z5 (Closest domain: F5X4Q2_STRPX 1-43) Number of domains in family: 43 Commentary (automatic): SUBNAME: FULL=ACETOLACTATE SUBUNIT SMALL SYNTHASE SYNTHASE FULL=AMINO ACT ACID-BINDING TRANSFERASE Length = 43 Score = 100 (43.1 bits), Expect = 0.0006 Identities = 19/43 (44%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Query:     11 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTL 53
               MRR+L+  L+N +G L+R  G+ S+R  NIES++V  T +P +
 Sbjct:      1 MRRMLTAKLQNSTGVLNRFTGVLSRRQVNIESISVGHTMEPNI 43

>PDB919Q9 (Closest domain: D5U4B0_BRAM5 75-175) Number of domains in family: 4 Commentary (automatic): SUBNAME: SMALL FULL=ACETOLACTATE SUBUNIT SYNTHASE FULL=PUTATIVE UNCHARACTERIZED SYNTHASE Length = 101 Score = 100 (43.1 bits), Expect = 0.001 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Query:     83 VRELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLYTVQLAGTSDKLD 142
               V  +    ++ R+ +LVKI+ +   R +V   T  + G I+ +     TV++   +  +D
 Sbjct:     77 VHLIDSSNNIIRDFLLVKIEINDSNRGKVCDITNSYNGLILYIGNKSITVEITAPASVID 136

 Query:    143 AFLASIRDVAKIVEVARSGVVGLSRGDKI 171
               A+L +++D   I+E++R+GV  +  GD +
 Sbjct:    137 AYLEALKDF-NILELSRTGVTSIQLGDDV 164