Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA1E6T6 score=106 PDD131H2 score=122 PD021323 score=134 PD478081 score=160 PDA021R6 score=181 PD478081 score=160 PDA1E6T7 score=156 PD884051 score=92


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA021R6
PD478081
PDA1E6T7
PD021323
PDD131H2
PD002844
PDA1E6T6
PD884051

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDA021R6
PDA1E6T7
PD021323
PDA1E6T6

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDA021R6
PDA1E6T7
PD021323
PDA1E6T6


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(96 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      9-28  #PDA1E6T6                                            106 2e-05
     10-85  #PDD131H2                                            122 3e-07
     11-78  #PD021323                                            134 4e-09
     11-50  #PD002844                                            111 5e-06
     15-78  #PD478081                                            160 7e-13
     29-62  #PDA021R6                                            181 3e-16
     64-96  #PD884051                                             92 0.002
     65-95  #PDA1E6T7                                            156 2e-12


>PDA021R6 (Closest domain: E8YCR4_ECOKO 29-62)
Number of domains in family: 169
Commentary (automatic):
SUBNAME: SUBUNIT SMALL FULL=ACETOLACTATE SYNTHASE EC=2.2.1.6 TRANSFERASE I ISOZYME SYNTHASE  
Length = 34
Score = 181  (74.3 bits), Expect = 3e-16
Identities = 34/34 (100%), Positives = 34/34 (100%)

 Query:     29 FARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRL 62
               FARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRL
 Sbjct:     29 FARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRL 62

>PD478081 (Closest domain: B0TFV8_HELMI 7-74) Number of domains in family: 2104 Commentary (automatic): SUBNAME: DEHYDROGENASE OXIDOREDUCTASE FULL=D-3-PHOSPHOGLYCERATE EC=1.1.1.95 SUBUNIT BIOSYNTHESIS FULL=PHOSPHOGLYCERATE FULL=L-SERINE BETA Length = 68 Score = 160 (66.2 bits), Expect = 7e-13 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 1/65 (1%)
 Query:     15 VRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQR-LEQMISQIDKLE 73
               V N PGV+ H+ GL ARRAFN+E I     +++D + I ++V  D R LEQ+++Q+ KL 
 Sbjct:      9 VENRPGVLVHIAGLIARRAFNIESITAGYTEEADVTRITIVVEGDNRNLEQVVNQLSKLV 68

 Query:     74 DVVKV 78
               DV+K+
 Sbjct:     69 DVIKI 73

>PDA1E6T7 (Closest domain: G7R4A0_ECOC2 65-95) Number of domains in family: 135 Commentary (automatic): SUBUNIT SUBNAME: SMALL FULL=ACETOLACTATE SYNTHASE EC=2.2.1.6 TRANSFERASE I ISOZYME I Length = 31 Score = 156 (64.7 bits), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 1/31 (3%)
 Query:     65 MISQIDKLEDVVKVQRNQSDPTMFNKIAVFF 95
               MISQIDKLEDVVKVQRNQSDPTMFNKIAVFF
 Sbjct:     65 MISQIDKLEDVVKVQRNQSDPTMFNKIAVFF 95

>PD021323 (Closest domain: G2SU43_BIFAN 16-87) Number of domains in family: 680 Commentary (automatic): SUBNAME: DOMAIN SUBUNIT ACID-BINDING FULL=AMINO ACT SMALL FULL=ACETOLACTATE SYNTHASE FULL=ACT Length = 72 Score = 134 (56.2 bits), Expect = 4e-09 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Query:     11 LELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVN-DDQRLEQMISQI 69
               L + V N PGV+  + GLFARRAFN+  +   P +  D S I +  + ++  LEQ+I Q+
 Sbjct:     16 LSVLVENRPGVLARIAGLFARRAFNINSLSVSPTERPDISRITVTADVEEVPLEQIIKQL 75

 Query:     70 DKLEDVVKV 78
               +KL  V+K+
 Sbjct:     76 NKLLHVLKI 84

>PDD131H2 (Closest domain: Q5SJ02_THET8 1-100) Number of domains in family: 2 Commentary (automatic): SUBNAME: SMALL FULL=ACETOLACTATE SUBUNIT SYNTHASE REFERENCE ILVN Length = 100 Score = 122 (51.6 bits), Expect = 3e-07 Identities = 28/77 (36%), Positives = 49/77 (63%), Gaps = 2/77 (2%)
 Query:     10 ILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVN-DDQRLEQMISQ 68
               ++ + V++HP V+  + GLFARR FN+E +          S I L+V+ DD+ LEQ+  Q
 Sbjct:      4 VISVLVQDHPRVLNRITGLFARRGFNLESLAVGTTHQPGLSRICLVVSGDDRTLEQVEKQ 63

 Query:     69 IDKLEDVVKVQRNQSDP 85
               +++L +V+KV  + ++P
 Sbjct:     64 LNRLIEVLKVT-DHTEP 79

>PD002844 (Closest domain: C7QE17_CATAD 3-45) Number of domains in family: 1321 Commentary (automatic): SUBNAME: SUBUNIT FULL=ACETOLACTATE SMALL SYNTHASE SYNTHASE EC=2.2.1.6 TRANSFERASE REGULATORY III Length = 43 Score = 111 (47.4 bits), Expect = 5e-06 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
 Query:     11 LELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKS 50
               L + V N PGV+T V GLFARRAFN+E +   P +  D S
 Sbjct:      6 LSVLVENKPGVLTRVAGLFARRAFNIESLAVGPTEHEDVS 45

>PDA1E6T6 (Closest domain: B2TUU7_SHIB3 9-28) Number of domains in family: 120 Commentary (automatic): SUBUNIT SUBNAME: SMALL FULL=ACETOLACTATE SYNTHASE EC=2.2.1.6 I TRANSFERASE ISOZYME I Length = 20 Score = 106 (45.4 bits), Expect = 2e-05 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 3/20 (15%)
 Query:      9 VILELTVRNHPGVMTHVCGL 28
               VILELTVRNHPGVMTHVCGL
 Sbjct:      9 VILELTVRNHPGVMTHVCGL 28

>PD884051 (Closest domain: A8G9P9_SERP5 65-97) Number of domains in family: 22 Commentary (automatic): SUBNAME: SMALL SUBUNIT SYNTHASE FULL=ACETOLACTATE EC=2.2.1.6 FULL=AMINO ACT DOMAIN ACID-BINDING Length = 33 Score = 92 (40.0 bits), Expect = 0.002 Identities = 17/33 (51%), Positives = 26/33 (78%), Gaps = 1/33 (3%)
 Query:     64 QMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ 96
               QMISQ++KLEDV++V+R+  D  +F ++  FFQ
 Sbjct:     65 QMISQVEKLEDVLQVKRHSEDVRVFEQLEAFFQ 97