Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC6B8P9 score=143 PD462196 score=496


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD462196
PDC6B8P9



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(189 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-46  #PDC6B8P9                                            143 6e-10
    49-187  #PD462196                                            496 6e-61


>PD462196 (Closest domain: D1GS27_STAA0 49-187)
Number of domains in family: 49
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PRECURSOR FLAGS: SIGNAL FULL=PROBABLE SERINE/THREONINE-PROTEIN AT5G35370  
Length = 139
Score = 496  (195.7 bits), Expect = 6e-61
Identities = 104/139 (74%), Positives = 104/139 (74%)

 Query:     49 FTHQNVKKHIIKFNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQIL 108
               FTHQNVKKHIIKFNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQIL
 Sbjct:     49 FTHQNVKKHIIKFNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQIL 108

 Query:    109 ENILGISIKNTRLSNKQLKVISKQRVQQFKXXXXXXXXXXXXXXXXALMLKWWXXXXXXX 168
               ENILGISIKNTRLSNKQLKVISKQRVQQFK                ALMLKWW       
 Sbjct:    109 ENILGISIKNTRLSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISI 168

 Query:    169 XXXXXXXXXXXXYEKYYTT 187
                           YEKYYTT
 Sbjct:    169 IVLIIITVAMIVYEKYYTT 187

>PDC6B8P9 (Closest domain: D9RQA2_STAAK 1-46) Number of domains in family: 47 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PRECURSOR FLAGS: SIGNAL FULL=PROBABLE FULL=MEMBRANE MW2248 Length = 46 Score = 143 (59.7 bits), Expect = 6e-10 Identities = 32/46 (69%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Query:      1 MALIVSRXXXXXXXXXXXXXXTVFPEQKLPLYIVFTLFVAVAIVSN 46
               MALIVSR              TVFPEQKLPLYIVFTLFVAVAIVSN
 Sbjct:      1 MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSN 46