Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC5T7U5 score=146 PD806801 score=231 PD235050 score=242 PDC68397 score=211 PD805332 score=424 PDA199H2 score=329 PD000838 score=114 PD118141 score=183 PD704893 score=143


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD805332
PD422726
PDA199H2
PDC4W198
PD235050
PD806801
PDC68397
PD981184
PD704903
PD118141
PDC3U396
PDB03876
PDC5T7U5
PD704893
PDB5C0Q6
PDB7R4Y9
PDC9G8B9
PDC4F5I8
PDB0E8K1
PD454104
PD000838
PDB5M3W7
PDC7Y921
PD877545



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(308 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      5-54  #PDC5T7U5                                            146 3e-09
      6-51  #PD806801                                            231 1e-21
     12-61  #PD235050                                            242 4e-23
    64-120  #PDC68397                                            211 9e-19
    66-161  #PD805332                                            424 5e-49
    87-139  #PD704903                                            192 1e-15
    87-164  #PDC3U396                                            176 2e-13
    87-151  #PD422726                                            347 8e-38
    87-118  #PDC9G8B9                                            126 9e-07
    88-121  #PDC7Y921                                            105 0.0006
    88-147  #PDB5C0Q6                                            141 1e-08
    98-137  #PD981184                                            202 1e-17
   148-211  #PDA199H2                                            329 3e-35
   149-209  #PDC4W198                                            312 5e-33
   160-211  #PDB03876                                            147 1e-09
   160-200  #PDB5M3W7                                            112 7e-05
   171-211  #PD454104                                            116 2e-05
   174-251  #PD877545                                             97 0.009
   175-211  #PDC4F5I8                                            123 2e-06
   177-211  #PDB7R4Y9                                            133 9e-08
   178-242  #PD000838                                            114 4e-05
   225-278  #PD118141                                            183 9e-15
   272-307  #PDB0E8K1                                            116 2e-05
   277-307  #PD704893                                            143 2e-09


>PD805332 (Closest domain: Q8FCP5_ECOL6 66-161)
Number of domains in family: 185
Commentary (automatic):
MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO PERMEASE ACID ABC TRANSPORTER  
Length = 96
Score = 424  (167.9 bits), Expect = 5e-49
Identities = 82/96 (85%), Positives = 82/96 (85%)

 Query:     66 IDTGWLLXXXXXXXXXXXXXXYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLT 125
               IDTGWLL              YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLT
 Sbjct:     66 IDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLT 125

 Query:    126 EGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIW 161
               EGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIW
 Sbjct:    126 EGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIW 161

>PD422726 (Closest domain: F4V7F0_ECOLX 71-151) Number of domains in family: 1511 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO PERMEASE ACID ABC TRANSLOCATOR Length = 81 Score = 347 (138.3 bits), Expect = 8e-38 Identities = 65/65 (100%), Positives = 65/65 (100%)
 Query:     87 YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNGQWVVGHS 146
               YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNGQWVVGHS
 Sbjct:     87 YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNGQWVVGHS 146

 Query:    147 ENFSA 151
               ENFSA
 Sbjct:    147 ENFSA 151

>PDA199H2 (Closest domain: C6EFB7_ECOBD 148-221) Number of domains in family: 1610 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID ABC TRANSLOCATOR Length = 74 Score = 329 (131.3 bits), Expect = 3e-35 Identities = 64/64 (100%), Positives = 64/64 (100%)
 Query:    148 NFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIAL 207
               NFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIAL
 Sbjct:    148 NFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIAL 207

 Query:    208 TFVI 211
               TFVI
 Sbjct:    208 TFVI 211

>PDC4W198 (Closest domain: Q3YW71_SHISS 149-209) Number of domains in family: 120 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC FULL=BRANCHED-CHAIN Length = 61 Score = 312 (124.8 bits), Expect = 5e-33 Identities = 61/61 (100%), Positives = 61/61 (100%)
 Query:    149 FSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIALT 208
               FSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIALT
 Sbjct:    149 FSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIALT 208

 Query:    209 F 209
               F
 Sbjct:    209 F 209

>PD235050 (Closest domain: G0GLL0_KLEPN 12-61) Number of domains in family: 2099 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO ACID TRANSLOCATOR Length = 50 Score = 242 (97.8 bits), Expect = 4e-23 Identities = 50/50 (100%), Positives = 50/50 (100%)
 Query:     12 MFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAAL 61
               MFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAAL
 Sbjct:     12 MFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAAL 61

>PD806801 (Closest domain: G7T872_SALET 6-51) Number of domains in family: 1234 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE TRANSLOCATOR FULL=INNER-MEMBRANE Length = 46 Score = 231 (93.6 bits), Expect = 1e-21 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Query:      6 LYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGS 51
               LYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGS
 Sbjct:      6 LYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGS 51

>PDC68397 (Closest domain: F4UF77_ECOLX 64-120) Number of domains in family: 74 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSLOCATOR Length = 57 Score = 211 (85.9 bits), Expect = 9e-19 Identities = 42/57 (73%), Positives = 43/57 (75%)
 Query:     64 MGIDTGWLLXXXXXXXXXXXXXXYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN 120
               +GIDTGWLL              YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN
 Sbjct:     64 LGIDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN 120

>PD981184 (Closest domain: E1WCZ4_SALTS 98-137) Number of domains in family: 154 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSPORTER Length = 40 Score = 202 (82.4 bits), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 2/40 (5%)
 Query:     98 PVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLF 137
               PVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLF
 Sbjct:     98 PVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLF 137

>PD704903 (Closest domain: C4XA54_KLEPN 78-167) Number of domains in family: 436 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC TRANSPORTER FULL=UREA TRANSPORTER Length = 90 Score = 192 (78.6 bits), Expect = 1e-15 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 1/53 (1%)
 Query:     87 YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNG 139
               YGW+IER+AYRP+RNS RL  LISAIGMS+ LQNYV L++G     +P+L +G
 Sbjct:     84 YGWAIERIAYRPLRNSTRLAPLISAIGMSLILQNYVQLSQGPNQQGIPTLLSG 136

>PD118141 (Closest domain: E3GAY6_ENTCS 222-278) Number of domains in family: 1481 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSLOCATOR Length = 57 Score = 183 (75.1 bits), Expect = 9e-15 Identities = 39/54 (72%), Positives = 39/54 (72%), Gaps = 1/54 (1%)
 Query:    225 QFYGVINPYIGFMAGMKAFTAAVLGGIGSIPXXXXXXXXXXXXXXXSSAYLSTE 278
               QFYGVINPYIGFMAGMKAFTAAVLGGIGSIP               SSAYLSTE
 Sbjct:    225 QFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGIAEALSSAYLSTE 278

>PDC3U396 (Closest domain: Q8FYS1_BRUSU 59-163) Number of domains in family: 2 Commentary (automatic): TRANSMEMBRANE SUBNAME: MEMBRANE FULL=BRANCHED-CHAIN PRECURSOR PERMEASE AMINO TRANSPORTER CELL FULL=INNER-MEMBRANE Length = 105 Score = 176 (72.4 bits), Expect = 2e-13 Identities = 37/78 (47%), Positives = 52/78 (66%), Gaps = 3/78 (3%)
 Query:     87 YGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNGQWVVGHS 146
               + W+IERVAYRP+R S RL  LI+AIGMSI L N+V +T+G R+  +P L NG + +  S
 Sbjct:     84 WSWAIERVAYRPLRGSFRLAPLITAIGMSIALSNFVQVTQGPRNKPVPQLLNGSYELFGS 143

 Query:    147 ENFSASITTMQAVIWIVT 164
                    +I+  Q V+ +VT
 Sbjct:    144 ---GVTISLKQIVVIVVT 158

>PDB03876 (Closest domain: G2T9P7_RHORU 155-218) Number of domains in family: 207 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE FULL=INNER-MEMBRANE TRANSLOCATOR AMINO ACID Length = 64 Score = 147 (61.2 bits), Expect = 1e-09 Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
 Query:    160 IWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIALTFVI 211
               IWI+T   M+  T  I  + MGR  RAC +D KMASL+G+N DR I+LTFVI
 Sbjct:    156 IWILTIGLMMGFTYVITQTSMGRQQRACEQDRKMASLIGVNVDRTISLTFVI 207

>PDC5T7U5 (Closest domain: G8AIG7_AZOBR 120-216) Number of domains in family: 5 Commentary (automatic): TRANSMEMBRANE MEMBRANE SUBNAME: CELL HELIX FULL=INNER-MEMBRANE TRANSLOCATOR COMPONENT AMINO ACID Length = 97 Score = 146 (60.8 bits), Expect = 3e-09 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Query:      5 FLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVS 54
                L+FLQQ+ N  T+   Y L+A+GYT+VYGI+G IN A GE+ MIG+ ++
 Sbjct:    145 LLFFLQQLINAATVACVYGLLALGYTLVYGILGQINLAMGELTMIGAMLT 194

>PD704893 (Closest domain: G0GLL0_KLEPN 277-307) Number of domains in family: 1056 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX AMINO ACID PERMEASE ABC TRANSPORTER Length = 31 Score = 143 (59.7 bits), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 1/31 (3%)
 Query:    277 TEYKDVVSFALLILVLLVMPTGILGRPEVEK 307
               TEYKDVVSFALLILVLLVMPTGILGRPEVEK
 Sbjct:    277 TEYKDVVSFALLILVLLVMPTGILGRPEVEK 307

>PDB5C0Q6 (Closest domain: Q1AUF0_RUBXD 86-174) Number of domains in family: 548 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSLOCATOR FULL=INNER-MEMBRANE PERMEASE ABC AMINO Length = 89 Score = 141 (58.9 bits), Expect = 1e-08 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Query:     88 GWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGSRDVALPSLFNGQWVVGHSE 147
               G  IERVAY+P+RNS RL  LI+AIGMS  LQN   L +G   V  P L +G  ++   E
 Sbjct:    101 GVGIERVAYKPLRNSPRLAVLITAIGMSFILQNVGLLWKGPAQVPFPDLISGANLLDSGE 160

>PDB7R4Y9 (Closest domain: A8GGR0_SERP5 207-250) Number of domains in family: 792 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC AMINO TRANSPORTER ACID Length = 44 Score = 133 (55.8 bits), Expect = 9e-08 Identities = 24/35 (68%), Positives = 30/35 (85%), Gaps = 6/35 (17%)
 Query:    177 YSRMGRACRACAEDLKMASLLGINTDRVIALTFVI 211
               ++R+GR CRA  +D KMAS+LGINTDRVI+L FVI
 Sbjct:    207 HTRLGRICRATQQDRKMASILGINTDRVISLVFVI 241

>PDC9G8B9 (Closest domain: A8GGR0_SERP5 95-149) Number of domains in family: 3 Commentary (automatic): SUBNAME: PLASMID FULL=INNER-MEMBRANE TRANSLOCATOR FULL=PUTATIVE FULL=PREDICTED UNCHARACTERIZED Length = 55 Score = 126 (53.1 bits), Expect = 9e-07 Identities = 23/32 (71%), Positives = 27/32 (84%), Gaps = 3/32 (9%)
 Query:     87 YGWSIERVAYRPVRNSKRLIALISAIGMSIFL 118
               YGW IER+AY+P+RNS RL  LISAIGMS+ L
 Sbjct:    118 YGWVIERIAYKPLRNSTRLAPLISAIGMSLIL 149

>PDC4F5I8 (Closest domain: F2GSH3_BRUM5 166-214) Number of domains in family: 204 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSLOCATOR FULL=INNER-MEMBRANE PERMEASE ACID AMINO Length = 49 Score = 123 (52.0 bits), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 3/37 (8%)
 Query:    175 IRYSRMGRACRACAEDLKMASLLGINTDRVIALTFVI 211
               +  + +GRA RAC +D KMA+LLGIN DRVI+LTFV+
 Sbjct:    169 VNRTSLGRAQRACEQDRKMAALLGINVDRVISLTFVM 205

>PDB0E8K1 (Closest domain: F4GJ55_SPICD 251-291) Number of domains in family: 736 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE AMINO ACID TRANSLOCATOR FULL=INNER-MEMBRANE Length = 41 Score = 116 (49.3 bits), Expect = 2e-05 Identities = 21/36 (58%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Query:    272 SAYLSTEYKDVVSFALLILVLLVMPTGILGRPEVEK 307
               SAY+ST Y+D +SF +LILVLL+MP G+ G+  V K
 Sbjct:    256 SAYISTGYRDAISFTILILVLLIMPNGLFGKKAVNK 291

>PD454104 (Closest domain: Q8YU25_NOSS1 170-232) Number of domains in family: 1801 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC TRANSPORTER TRANSLOCATOR FULL=INNER-MEMBRANE Length = 63 Score = 116 (49.3 bits), Expect = 2e-05 Identities = 24/41 (58%), Positives = 29/41 (70%), Gaps = 2/41 (4%)
 Query:    171 LTIFIRYSRMGRACRACAEDLKMASLLGINTDRVIALTFVI 211
               LT FI  ++ G+A +A AED   ASLLGIN+DR I LTF I
 Sbjct:    180 LTYFINRTKYGKAIQAIAEDATTASLLGINSDRFIVLTFFI 220

>PD000838 (Closest domain: C7LRG9_DESBD 185-255) Number of domains in family: 3013 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX PERMEASE ABC TRANSPORTER TRANSLOCATOR FULL=INNER-MEMBRANE Length = 71 Score = 114 (48.5 bits), Expect = 4e-05 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Query:    178 SRMGRACRACAEDLKMASLLGINTDRVIALTFVIXXXXXXXXXXXXXQFYGVINPYIGFM 237
               +RMG+A +A AE+ + ASLLGIN DR I  TF I               +G+  PY G  
 Sbjct:    187 TRMGKALQATAENPETASLLGINVDRYILSTFFISGALGGLAGTLIGASFGLAGPYFGVS 246

 Query:    238 AGMKA 242
                G+K 
 Sbjct:    247 YGLKG 251

>PDB5M3W7 (Closest domain: B8AVA6_ORYSI 40-86) Number of domains in family: 14 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED REFERENCE FULL=PREDICTED NUCLEOTIDE-BINDING F13K9.9 FULL=AT1G27990 ATP-BINDING FULL=UNCHARACTERIZED Length = 47 Score = 112 (47.8 bits), Expect = 7e-05 Identities = 22/41 (53%), Positives = 29/41 (70%), Gaps = 7/41 (17%)
 Query:    160 IWIVTFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGIN 200
               I +V+ L M  LT  I+ +R+GR CRA  +D KMAS+LGIN
 Sbjct:     46 ILVVSLLGMAILTYIIQRTRLGRICRATQQDRKMASILGIN 86

>PDC7Y921 (Closest domain: D7CUW0_TRURR 191-245) Number of domains in family: 6 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX FULL=INNER-MEMBRANE TRANSLOCATOR AMINO ABC ACID Length = 55 Score = 105 (45.1 bits), Expect = 0.0006 Identities = 19/34 (55%), Positives = 27/34 (79%), Gaps = 6/34 (17%)
 Query:     88 GWSIERVAYRPVRNSKRLIALISAIGMSIFLQNY 121
               G +++RVAYRP+R + R+  LI+AI MS FLQN+
 Sbjct:    208 GITLDRVAYRPLRGAPRISLLITAIAMSFFLQNF 241

>PD877545 (Closest domain: G2TE48_RHORU 160-235) Number of domains in family: 411 Commentary (automatic): MEMBRANE TRANSMEMBRANE SUBNAME: CELL HELIX TRANSLOCATOR FULL=INNER-MEMBRANE PERMEASE ACID AMINO Length = 76 Score = 97 (42.0 bits), Expect = 0.009 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 2/78 (2%)
 Query:    174 FIRYSRMGRACRACAEDLKMASLLGINTDRVIALTFVIXXXXXXXXXXXXXQFYGVINPY 233
               F RYSR G A RA A D + A  LGI+  RV A+ + I                GV +  
 Sbjct:    160 FFRYSRHGLAMRATAFDQQAAQSLGISVKRVFAMAWAISAMVSALAGVVMGMVNGV-SSA 218

 Query:    234 IGFMAGMKAFTAAVLGGI 251
               + F+ G+K F A +LGG+
 Sbjct:    219 LSFV-GIKVFPAVILGGL 235