(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020370

fig|585159.3.peg.9   Staphylococcus aureus subsp. aureus M899     MEAIKVQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLSLPEISFK
fig|1158485.3.peg.697   Staphylococcus aureus M1311          MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLSLPEISFK
fig|1158495.3.peg.2477   Staphylococcus aureus M1462          MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLSLPEISFK
fig|279808.3.peg.620   Staphylococcus haemolyticus JCSC1435            LTKPVKIAISIYLAMVLLVCSSYLVLILVGSLQGNDMSSSVLDTDHQHINSVTK           
fig|1034809.4.peg.456   Staphylococcus lugdunensis N920143            MAKSRKIVISIYLGTVFIACTTYLALILIGSLQGNDMSNSVLDTDHRYIN               
fig|342451.4.peg.175   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305            MSKSVKLVVSIYLAVVVIICCSYLIMILVGSFQGNDMRGSVLDTDNT                  
fig|629742.3.peg.1265   Staphylococcus hominis SK119            MAKPVKIAVGIYLALVLLACSSYLIFILIGSLQGNDMSHSVLDTDPRYINNRSQ           
fig|553212.3.peg.95   Staphylococcus capitis SK14            MDKPVKLAVGVYLAIILVVCSCYLAFILIGSLQGKDMSNSVLDSDHSRINNTSR           
fig|525378.3.peg.2183   Staphylococcus epidermidis M23864:W1            MDKPVKLAVGIYLAIILVICSCYLAFILIGSLQGKDMSNSVLDSDHSRINNTSR           
fig|596319.3.peg.28   Staphylococcus warneri L37603            MEKSVKFAIGIYLAIILIVTTLYLSFILIGSLQGKDMTNSVLDTDHTKINNKTR           
fig|1220510.3.peg.1515   Staphylococcus epidermidis AU12-03            MEKSVKLAVGIYLAIILIICSSYLAFILIGSLNGKDMSNSVLDTDHSRINNTSR           
fig|979215.3.peg.2189   Staphylococcus epidermidis NIHLM018            MEKSVKLAVGIYLAIILIICSIYLAFILIGSLSGKDMSNSVLDTDHSRINNTSR           
fig|979204.3.peg.1941   Staphylococcus epidermidis NIHLM061            MEKSVKLAVGIYLAIILIICSIYLAFILIGSLNGKDMSNSVLDTDHSRINNTSR           
fig|904321.3.peg.498   Staphylococcus epidermidis VCU045            MEKSVKLAVGIYLAIILIICSIYLAFILIGSLNGKDMSNSVLDTDHSRINNTSR