(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00014712

fig|525374.3.peg.2053   Staphylococcus epidermidis BCM-HMP0060             GQRYAVIQLKTKYNAAFLKSEFDKWEQRIDDMYALHYPRMFIDPYTMQLSYESNHIEDLALSIIEEREKLEKFKHKSNHDLKKFNIILSNYSDSEQRQIKRYQRDDILADESLILRICEDISNIDSKDKNNRNT−−AIQEEIKA−−DKERRRAEGKARKER
fig|525376.3.peg.1185   Staphylococcus epidermidis W23144             GQRYAVIQLKTKYNAAFLKSEFDKWEQRIEDMYALHYPRMFIDPYTMQLSYESNHIEDLALSIIEEREKLEKFKHKSNHDLKKFNIMLSNYSESEQRQIKRYQRDDVLADESLILRICEDISNIDSKDKNNRNI−−AIQEEIKA−−DKKRRRAEGKARKER
fig|629742.3.peg.507   Staphylococcus hominis SK119             QEKVSDYELFTRFNTYYIQSRIALIESDIEDMYDRTTPSLCSDTVSESIYYESYSVENLAIAILEERQKLERYKSRSQRDLNAFYTVLGRFSTKEQKYIKNYINTRSEAHMNVIERFKIELHKYIQTNRNERNKGIENNYSYI−−−NDKRQKVKTYPHKLT
fig|596319.3.peg.1411   Staphylococcus warneri L37603             ADKVCDYELLTRFNPTYIQEKIALIENDIESMYDRTYPHLVGDTVMDSIYYESFSLEHLALDIIDQKERLAKYKQKSKYYLKCFYTVLEHYTPQERHIIKFSIRKHHIPDTALLECFKHELYEFIEHMRGQYSQ−−SKVYEYK−−−SKDGQRSNTYAHRLT
fig|553590.4.peg.2240   Staphylococcus aureus A9754          FESNDKITEVELLMHYNPKVINSKIKAMRSQIESLYHLNMNHVITNDNDMLVSVSYPLDKLVLYIIEEKDKLEYYMKTAQDRLNLFKNIIKNYSENEQQDVMRYMLSSGKVKNEGVIERLKVDIYKVESRKRQERQN−−QREELHRIEFNKHLEQVKKEL    
fig|367830.3.peg.99   Staphylococcus aureus subsp. aureus USA300                       MHYNPKVINSKIKAMRSQIESLYHLNMNHVITNDNDMLVSVSYPLDKLVLYIIEEKDKLEYYMKTAQDRLNLFKNIIKNYSENEQQDVMRYMLSSGKVKNEGVIERLKVDIYKVESRKRQERQN−−QREELHRIEFNKHLEQVKKEL    
fig|585155.3.peg.639   Staphylococcus aureus subsp. aureus H19          FESNDKITEVELLMHYNPKVINSKIKAMRSQIESLYHLNMNHVITNDNDMLVSVSYPLDKLVLYIIEEKDKLEYYMKTAQYRLNLFKDIIKNYSENEQQDVMRYMLSSGKVKNEGVIERLKVDIYKVESRKRQERQN−−QREELHRIEFNKHLEQVKKEL    
fig|931441.3.peg.954   Staphylococcus aureus subsp. aureus CIG1835          FESNDKITEVELLMHYNPKVINSKIKAMRSQIESLYHLNMNHVITNENDMLVSVSYPLDKLVLYIIEEKDKLEYYMKTAQDRLNLFKDIIKNYSENEQQDVMRYMLSSGKVKNEGVIERLKVDIYKVESIKRQERQN−−KREELHRIEFDKHLEQVKKEL    
fig|629742.3.peg.672   Staphylococcus hominis SK119      CLYYR−−EAKITEYALLTEFSPQFINSKIKGIKLQIEAMYYLNISHSSSSDVFGFVSVSYPLEKLVIHILEEKAKLNAYIKRSSKKLALFKEVVKGYTPSEQKEIMYYIRSNGAAVNSELINRLRCDLYKAIHSHK                                
fig|279808.3.peg.925   Staphylococcus haemolyticus JCSC1435             ENKISEYTLLTEYNPKFINTKIKAITMQIEMMYHLNISHMTTSDVHGVITISYPLEKLAITIIEEKEKLKYFKTKSNRNMQQLKQAIKRYTPGEQKEIMYYMQSNGSTIDYDLIERLQRDLYKLRQK                                  
fig|279808.3.peg.1090   Staphylococcus haemolyticus JCSC1435             ENKISEYTLLTEYNPKFINTKIKAITMQIEMMYHLNISRMTTSEVHGVVSISYPLEKLAIDIIDEKEKLNCFKTKSNRNMQQLKQVIKRYTPGEQKEIMYYMQSNGSTIDYDLIERLQRDLYKLRHANKQK                              
fig|342451.11.peg.1926   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305              EKITEYELLTAYNPVFINRKIQTIEEQIECMYSLNTSHMTCDDVMGVVTTSYPLEKLVCWIVEKKDELDRYKKQSNKRLNLVKKLIKHYPSHEQKAIIQYMQSNGSYKPHKMIEKLQKDLYQVHHKNRSQRRE−−KHIQANKVIYNDYIETKRESLQNER
fig|396513.4.peg.1523   Staphylococcus carnosus subsp. carnosus TM300     ILWYYE−−EPKITEYELLTQYSPMMINSKLRVIQEQIDAMYHLNTSHMCCDEVEGVITVSYPLEKLVFWIIQQKEELDRFKNNSTKKLNLLKKIIRRYTPREQKEVMRYFQTNGSDRPHKTIDKLQEDLYKVHHNERIERNK−−QRQKESE                  
fig|1224923.3.peg.670   Staphylococcus aureus M0240      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNIAIE−−−NSKIARVNAYHQSSY
fig|585151.3.peg.1720   Staphylococcus aureus subsp. aureus C427                                                          MGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNAYHQSSY
fig|93062.19.peg.883   Staphylococcus aureus subsp. aureus COL      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNAYHQSSY
fig|548473.3.peg.1088   Staphylococcus aureus subsp. aureus TCH60      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNAYHQSS 
fig|553568.3.peg.1840   Staphylococcus aureus A6224      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKIVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNAYHQSS 
fig|1112349.3.peg.1159   Staphylococcus aureus subsp. aureus NN50      CLYYRNGDNKLSDYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKAGLQNYKNRSISNMVLLKTVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNEYHQSSY
fig|681288.4.peg.803   Staphylococcus aureus subsp. aureus ED98      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKARLQNYKNRSISNMVLLKTVLNHYTEKEQKQVVKYMRSNGRYKPYSVIERLQVELYQASIKQRSERQK−−QRNTAIE−−−NSKIARVNAYHQSSY
fig|585152.3.peg.293   Staphylococcus aureus subsp. aureus D139      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKARLQNYKKRSISNMVLLKTVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNIAIE−−−NSKIARVNAYHQSSY
fig|585155.3.peg.2628   Staphylococcus aureus subsp. aureus H19      CLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHLSASTTTCDEIMGIVSVSYPIEKLVIKIIETKARLQNYKNRSISNMVLLKTVLNHYTEKEQKQVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNIAIE−−−NSKIARVNAYHQSS 
fig|273036.6.peg.392   Staphylococcus aureus RF122      CLYYRNGDNKLSEYQLLTQFNPTFINKKIRMCEFQIESMYHMSASTTTCDEMMGVVSVSYPIEKLVIKIIETKARLQNYKNRSISNMVLLKTVLNHYTEKEQKKVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNIAIE−−−NSKIARVNAYHQSSY
fig|273036.6.peg.2003   Staphylococcus aureus RF122      CLYYRNGDNKLSEYQLLTQFNPTFINKKIRMCEFQIESMYHMSASTTTCDEMMGVVSVSYPIEKLVIKIIETKARLQNYKNRSISNMVLLKTVLNHYTEKEQKKVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQK−−QRNIAIE−−−NSKIARVNAYHQSSY