(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020510

fig|279808.3.peg.2604   Staphylococcus haemolyticus JCSC1435     MNNNKIFWINIFMTLLFLGFNIIVTYNADLDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIVMLLYYIYPMVYTFF 
fig|279808.8.peg.2032   Staphylococcus haemolyticus JCSC1435     MNNNKIFWINIFMTLLFLGFNIIVTYNADLDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIVMLLYYIYPMVYTFF 
fig|629742.3.peg.136   Staphylococcus hominis SK119     MNINKLFWINIMITLLFLGFNIIVTYFPKLDDYFWLIPGLIICGLTISFSLIAAILDKNLISEIIFLTNLIIFLYYIYPLIYNFF 
fig|1157021.3.peg.279   Staphylococcus aureus M0328     MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG
fig|1158486.3.peg.316   Staphylococcus aureus M1320     MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG
fig|93062.19.peg.844   Staphylococcus aureus subsp. aureus COL     MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG
fig|273036.6.peg.806   Staphylococcus aureus RF122     MNNILSNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG
fig|452948.4.peg.2555   Staphylococcus aureus 930918-3     MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFL                   
fig|585155.3.peg.2160   Staphylococcus aureus subsp. aureus H19     MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYRFIG
fig|596319.3.peg.775   Staphylococcus warneri L37603     MKRYILHAINIILTILLIIFNVIITYNTNLDETLWLVPGLIVCGLIMMISFTIAITIKDLLSEVLFFINIILTLYYIYPIFYDFL 
fig|553212.3.peg.567   Staphylococcus capitis SK14     MKIFSINVINILLTILFIAFNVLITYNANVDNQLWLIPGLCICGVALFTSLIIAIIYTDLLSEIIFFINIVLALYYIYPIFYDFL 
fig|525378.3.peg.1258   Staphylococcus epidermidis M23864:W1     MKIISVNVINIILTVLFIAFNVLITYNANVDNHLWLIPGLCICGIALFTSLTIAIIYTDLLSEILFFINIVLALYYIYPIFYDFL 
fig|525376.3.peg.216   Staphylococcus epidermidis W23144     MKLNKANVFNLIFTILFFTFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPIFYEFV 
fig|525375.3.peg.1594   Staphylococcus epidermidis M23864:W2(grey)     MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPIFYEFV