(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00007614

fig|226900.1.peg.2337   Bacillus cereus ATCC 14579                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGSTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|226900.8.peg.2496   Bacillus cereus ATCC 14579                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGSTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|526991.3.peg.5720   Bacillus cereus AH676                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGSTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|526969.3.peg.2097   Bacillus cereus m1550                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGSTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|1053240.3.peg.2459   Bacillus cereus VD166                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGSTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|527027.3.peg.3093   Bacillus thuringiensis serovar pakistani str. T13001                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNNE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEENGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|405533.4.peg.4068   Bacillus cereus AH1134                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YKDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEENGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|526967.3.peg.2701   Bacillus cereus 172560W                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEENGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|405532.5.peg.2343   Bacillus cereus B4264                                                        NEQVRFEDLKGH−−WGEKHANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEENGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|526987.3.peg.1563   Bacillus cereus Rock4-2                                                        NDQVRFEDLKGH−−WGEKYANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|1053215.3.peg.2949   Bacillus cereus ISP2954                                                        NDQVRFEDLKGH−−WGEKYANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEVITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|527019.3.peg.3329   Bacillus thuringiensis IBL 200                                                      NYNEQVRFEDLKGH−−WGEKYANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNLNDE−−−KEIITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEMDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|718222.3.peg.3401   Bacillus cereus TIAC219                                                      NYNEQVRFEDLKGH−−WGEKYANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNSNDE−−−KEIITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|527020.3.peg.3346   Bacillus thuringiensis IBL 4222                                                      NYNEQVRFEDLKGH−−WGEKYANILIDLKISNGTENGWQPNRFITRAEAAQLTAKTDMLQQNSNDE−−−KEIITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVSAHYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQKHNLFGLRAYDG−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPSYGDSIAYNANYVRERYLEESGMYYNGPTL−−−−−−−−−−−−−−−−−−−−−TGMNVKYASDKGWAKKIAGIME                                          
fig|405533.4.peg.5792   Bacillus cereus AH1134                                                                                                   TRAEAAQLTAKTDMLQQNQNNGLKDKEIITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVNAQYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDK−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTYGDSIAYNANYVRERYLEEDGMHYNGPTL−−−−−−−−−−−−−−−−−−−−−AGMNVKYASDKGWAGKIANIME                                          
fig|526980.3.peg.1277   Bacillus cereus ATCC 10876                                                                                               NRSITRAEAAQLTAKTDMLQQNQNNGLKDKEIITATS−−−−−−−YEDLN−−−LTVA−−SKITAQEIDSFIAKYH−−−−−−−−−SDSPLVGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVNAQYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDK−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTYGDSIAYNANYVRERYLEEDGMHYNGPTL−−−−−−−−−−−−−−−−−−−−−AGMNVKYASDKGWAGKIANIME                                          
fig|1053240.3.peg.5904   Bacillus cereus VD166                                                      HENGQSKFEDLKGH−−WGEKYANILIDLKISNGTDNGWQPNRSITRAEAAQLTAKTDMLQQNLNDG−−−NEIITATS−−−−−−−YEDLN−−−LTVS−−SNITAQEIDSFIAEYH−−−−−−−−−SDSPLIGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDK−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTYGDSIAYNANYVRERYLEEDGMHYNGPTL−−−−−−−−−−−−−−−−−−−−−DGMNVKYASDKGWAGKIANIME                                          
fig|451709.4.peg.5895   Bacillus cereus 03BB108                                                      HENGQSKFEDLKGH−−WGEKYANILIDLKISNGTDNGWQPNRSITRAEAAQLTAKTDMLQQNLNDG−−−NEIITATS−−−−−−−YEDLN−−−LTVS−−SNITAQEIDSFIAEYH−−−−−−−−−SDSPLIGH−−−−−−−−−−−−−−−−−−GQDFINAQNQYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDK−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTYGDSIAYNANYVRERYLEEDGMHYNGPTL−−−−−−−−−−−−−−−−−−−−−DGMNVKYASDKGWAGKIANIME                                          
fig|526986.3.peg.4063   Bacillus cereus Rock3-44                                                         MQTGFASING−−−−−−−−−−−−−−VTYYFNNSGTWIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENKITATS−−−−−−−YINLD−−−LTYA−−SNVTGKEIDADIQKYQ−−−−−−−−−PDSPLIGH−−−−−−−−−−−−−−−−−−GDDFVAAQAKYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDW−−−−D−−−−−−P−−−−−−FKH−−−−−−−−−−−−−−−−−−AKYLPTFGDSIAYNADYVRDKYLEENGEYYYGPTL−−−−−−−−−−−−−−−−−−−−−QGMNVMYSTDQEWSDKIAKIME                                          
fig|1053245.3.peg.1474   Bacillus cereus VD214                                                         MQTGTASING−−−−−−−−−−−−−−TTYHFDKSGAWTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNITATT−−−−−−−YLDLD−−−LTYA−−SNVTGAEIDANIKKYH−−−−−−−−−PDSPLIGH−−−−−−−−−−−−−−−−−−GNDFVEAQAKHGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDA−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTFGDSISYNANYVREKYLEANGSYFNGPTL−−−−−−−−−−−−−−−−−−−−−KGMNVMYSTDQEWSAKIVKIME                                          
fig|526981.3.peg.1449   Bacillus cereus Rock1-3                                                         MQTGTASING−−−−−−−−−−−−−−TTYHFDKSGAWIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNITATT−−−−−−−YLDLD−−−LTYA−−SNVTGAEIDANIKKYH−−−−−−−−−PDSPLIGH−−−−−−−−−−−−−−−−−−GNDFVEAQAKHGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDA−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTFGDSISYNANYVREKYLEANGSYFNGPTL−−−−−−−−−−−−−−−−−−−−−KGMNVMYSTDQEWSAKIVKIME                                          
fig|526988.3.peg.1520   Bacillus cereus Rock4-18                                                         MQTGTASING−−−−−−−−−−−−−−TTYHFDKSGAWIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNITATT−−−−−−−YLDLD−−−LTYA−−SNVTGAEIDANIKKYH−−−−−−−−−PDSPLIGH−−−−−−−−−−−−−−−−−−GNDFVEAQAKHGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDA−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTFGDSISYNANYVREKYLEKNGSYFNGPTL−−−−−−−−−−−−−−−−−−−−−KGMNVMYSTDQEWSAKIVKIME                                          
fig|526983.3.peg.301   Bacillus cereus Rock3-28                                                         MQTGTASING−−−−−−−−−−−−−−TTYHFDKSGAWIP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNITATT−−−−−−−YLDLD−−−LTYA−−SNVTGAEIDANIKKYH−−−−−−−−−PDSPLIGH−−−−−−−−−−−−−−−−−−GNDFVEAQAKHGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDA−−−−D−−−−−−P−−−−−−FKY−−−−−−−−−−−−−−−−−−AKYLPTFGDSISYNANYVREKYLEKNGSYFNGPTL−−−−−−−−−−−−−−−−−−−−−KGMNVMYSTDQEWSAKIVKIME                                          
fig|486619.4.peg.1970   Bacillus anthracis str. A0193                                                QNAFKFKIKAQHTFNDVPSTHWANDAVSALESNGITAGNGAGAFNPTSVLTREEYAQFLFNAM−−−−−−−−−−−−−−−−−−AS−−−−−−−YINLD−−−ITLP−−SNITAQEIDNFIEKWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESAYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKQSISYNADYVRKNYLEEGANHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNEKYATDKEWAGKIANIMERIKPFNKKDYQNVK                            
fig|405535.8.peg.1803   Bacillus cereus AH820                                                QNAFKFKIKAQHTFNDVPSTHWANDAVSALESNGITAGNGAGAFNPTSVLTREEYAQFLFNAM−−−−−−−−−−−−−−−−−−AS−−−−−−−YINLD−−−ITLP−−SNITAQEIDNFIEKWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESAYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKQSISYNADYVRKNYLEEGANHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNEKYATDKEWAGKIANIMERIKPFNKKDYQNVK                            
fig|486622.3.peg.1358   Bacillus anthracis str. A0174                                                QNAFKFKIKAQHTFNDVPSTHWANDAVSALESNGITAGNGAGAFNPTSVLTREEYAQFLFNAM−−−−−−−−−−−−−−−−−−AS−−−−−−−YINLD−−−ITLP−−SNITAQEIDNFIEKWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILGSAYGKSEMA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRRHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKQSISYNADYVRKNYLEEGANHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNEKYATDKEWAGKIANIMERIKPFNKKDYQNVK                            
fig|405917.4.peg.1456   Bacillus cereus W                                                QNAFKFKIKAQHTFNDVPSTHWANDAVSALESNGITAGNGAGAFNPTSVLTREEYAQFLFNAM−−−−−−−−−−−−−−−−−−AS−−−−−−−YINLD−−−ITLP−−SNITAQEIDNFIEKWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESAYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANIMERIKPFNKKDYQNVK                            
fig|347495.3.peg.1673   Bacillus cereus F837/76                                                                                                    RESYAQLLYRAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−ADSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESAYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKESISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|451709.4.peg.2613   Bacillus cereus 03BB108                                                                                                    RESYAQLLYRAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−ADSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESAYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKESISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|572264.4.peg.1702   Bacillus cereus 03BB102                                                                                                    RESYAQLLYRAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−ADSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|526985.3.peg.3638   Bacillus cereus Rock3-42                                                                                                    RESYAQLLYRAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−ADSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANIMERIKPFNKKDYENVK                            
fig|405534.9.peg.2108   Bacillus cereus AH187                                                QKAFKLEVKAPHTFDDIDATYWWAKEAISALQSNGVAAGNGLGGFDPSGVLTRESYAQLLYKAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−PDSPLVGN−−−−−−−−−−−−−−−−−−GKDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLKAFDW−−−−E−−−−−−P−−−−−−FAN−−−−−−−−−−−−−−−−−−AKYLPSYAQSISYNADYVRKNYLEEGADHFHGYTL−−−−−−−−−−−−−−−−−−−−−PAMNEKYATDKEWAGKIANIMERIKPFNKKDYENVK                            
fig|526973.3.peg.3153   Bacillus cereus m1293                                                QKAFKLEVKAPHTFDDIDATYWWAKEAISALQSNGVAAGNGLGGFDPSGVLTREGYAQLLYKAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIKKSH−−−−−−−−−PDSPLVGN−−−−−−−−−−−−−−−−−−GKDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLKAFDW−−−−E−−−−−−P−−−−−−FAN−−−−−−−−−−−−−−−−−−AKYLPSYAQSISYNADYVRKNYLEEGADHFHGYTL−−−−−−−−−−−−−−−−−−−−−PAMNEKYATDKEWAGKIANIMERIKPFNKKDYENVK                            
fig|526992.3.peg.5244   Bacillus cereus AH1271                                                                                                    RESYAQLLYKAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YMNLD−−−VTLP−−SNVTALEIDEFIKNSH−−−−−−−−−ADSPLIGT−−−−−−−−−−−−−−−−−−GKDFVQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLKAFDW−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKESISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKAWAGKIANIMERIKPFNNKDYENVK                            
fig|527029.3.peg.689   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1                                                                                                    RESYAQLLYRAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDGFIKEWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVKRLPKNPNTLNVETLGKEIPYKDYAKDAK
fig|288681.15.peg.1711   Bacillus cereus E33L                                                QKAFKLEVKAPHTFDDIDATYWWAKEAISALQSNGVAAGNGLGGFDPSGVLTREGYAQLLYKAMQIKK−−−−−−−−DVPVEQPS−−−−−−−YMNLD−−−VTLP−−SNITAQEIDGFIKEWH−−−−−−−−−PDSPLIGT−−−−−−−−−−−−−−−−−−GQDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|269801.5.peg.1284   Bacillus cereus G9241                                           MSVILQRAFQLEVKAPHTFNDIDATHWWAKEAISALQSNGVSVGNGLGGFDPSGVLTRESYAQLLYRAMQLKK−−−−−−−−DVPEEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIEKSH−−−−−−−−−SDSPLIGT−−−−−−−−−−−−−−−−−−GKDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|269801.1.peg.1262   Bacillus cereus G9241                                           MSVILQRAFQLEVKAPHTFNDIDATHWWAKEAISALQSNGVSVGNGLGGFDPSGVLTRESYAQLLYRAMQLKK−−−−−−−−DVPEEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNFIEKSH−−−−−−−−−SDSPLIGT−−−−−−−−−−−−−−−−−−GKDFIQAQNEYGVSALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYKDSISYNADYVRKNYLEKGADHFNGYTL−−−−−−−−−−−−−−−−−−−−−PAMNIKYATDKEWAGKIANLMERIKPFNKKDYENVK                            
fig|526976.3.peg.4146   Bacillus cereus BDRD-ST196                                                QRAFKLEVKAPHTFNDIDATHWWAKEAISALQSNGVSVGNGLGGFDPSGVLTRESYAQLLYKAMKIKN−−−−−−−−DVPVEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNYIKRYH−−−−−−−−−PDSPLVGV−−−−−−−−−−−−−−−−−−GQDFIKAQNEYGVNSLYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDW−−−−D−−−−−−P−−−−−−FAH−−−−−−−−−−−−−−−−−−AKYLPSYGLSISYNADYVRKNYLEQGAKYFKGYTL−−−−−−−−−−−−−−−−−−−−−PAMNVMYSTDKEWAGKIANIMERIKPFNNKDYQNVK                            
fig|222523.1.peg.1878   Bacillus cereus ATCC 10987                                                QRAFKLEVKAPHTFNDIDASYWWAKEAISALQSNGVSIGNGLGGFDPSGVLTRESYAQLLYRAMQIKK−−−−−−−−DVPAEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNYIQRFH−−−−−−−−−PDSPLVGI−−−−−−−−−−−−−−−−−−GQDFIKAQNEYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYGLSISYNADYVKKNYLEEGARYFKGYTL−−−−−−−−−−−−−−−−−−−−−PAMNVMYSTDTAWAGKIANIME                                          
fig|527024.3.peg.3005   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                                                QRAFKLEVKAPHTFNDIDATHWWAKEAISALQSNGVSVGNGLGGFDPSGVLTRESYAQLLYRAMQLKK−−−−−−−−DVPEEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNYIQRFH−−−−−−−−−PDSPLVGI−−−−−−−−−−−−−−−−−−GQDFIKAQNEYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYGLSISYNADYVKKNYLEDGARYFKGYTL−−−−−−−−−−−−−−−−−−−−−PAMNVMYSTDTAWAGKIANIME                                          
fig|526977.3.peg.1386   Bacillus cereus ATCC 4342                                                QRAFKLEVKAPHTFNDIDATHWWAKEAISALQSNGVSVGNGLGGFDPSGVLTRESYAQLLYRAMQLKK−−−−−−−−DVPEEQPS−−−−−−−YINLD−−−VTLP−−SNVTAQEIDNYIQRFH−−−−−−−−−PDSPLVGI−−−−−−−−−−−−−−−−−−GQDFIKAQNEYGVNALYLAAHAILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNLFGLRAYDR−−−−D−−−−−−P−−−−−−FAY−−−−−−−−−−−−−−−−−−AKYLPSYGLSISYNADYVKKNYLEDSARYFKGYTL−−−−−−−−−−−−−−−−−−−−−PAMNVMYSTDTAWAGKIANIME                                          
fig|526976.3.peg.2622   Bacillus cereus BDRD-ST196                                                                                                           INKEKQINK−−−−−−−−STEFTAKS−−−−−−−YLELD−−−LRLP−−SKINAKDIDDYIAKYH−−−−−−−−−PDSPLVGH−−−−−−−−−−−−−−−−−−GKDYIEAEEKYGVNAHAMAAKDILESGYGKSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YRKHNTSGLRAYDR−−−−D−−−−−−P−−−−−−FYY−−−−−−−−−−−−−−−−−−AKYLPSYKDSVFYTTSYIRENYLEEKGKYYNGTTL−−−−−−−−−−−−−−−−−−−−−TGVNTMYCTDKAWSSKIASIM                                           
fig|521098.4.peg.701   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446                                                                       VGNSTSNSTGNATSNGTGNSTGNSTGNSTGGS−−−−−−−−−−−−−−−−−−−−−−−−−SGLS−−−−−−−FTNVD−−−LRYPAPSNINAQSINQFL−−LQ−−−−−−−−−NSSPLNGL−−−−−−−−−−−−−−−−−−GNSFMDAQNLYSVDANYLVSHAILESAWGQSQIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQKNNLFGYGAYDS−−−−N−−−−−−P−−−−−−GQD−−−−−−−−−−−−−−−−−−AGVFPSDDYAIRFEAWTVRTNYLTPGASLYVSPTL−−−−−−−−−−−−−−−−−−−−−SGMNVNYATAKTWASGIAALMTQF                                        
fig|398511.4.peg.1127   Bacillus pseudofirmus OF4                                                                                                              QVYYSLNGYDFFNVSGQKVGTA−−−−−−−YQYFNFLPLRTK−−TNYTAEDLNRYIASVNQTINGKNVATDSPLLNL−−−−−−−−−−−−−−−−−−GHVFIEAQEKYGINALYLFGKAIHESSYGLSVIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQRKNLFGYGAYDS−−−−D−−−−−−P−−−−−−LGN−−−−−−−−−−−−−−−−−−AKPFNSFEESIHHVANSMNNRYLTPGGDQYRGAVLGLKG−−−−−−−−−−−−−−−−−HGMNVNYASDPLWGQKIASHM−−−−−−−−−−YRADNFLGKKDY                     
fig|471223.3.peg.3252   Geobacillus sp. WCH70                                                                                                                           TAGKPIGTA−−−−−−−YQYFNVLPIRTK−−TNYTAEELNRFVAANR−−−−−−−−−SDSPLKTL−−−−−−−−−−−−−−−−−−GEAFKKTEEKYNVNALYLLAHAIHESDWGTSEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEKKNLFGIRAVDS−−−−D−−−−−−P−−−−−−LNS−−−−−−−−−−−−−−−−−−AVKFNTFEDCINYMAQTIVSNRYANPKDWRYSGAVLGDKT−−−−−−−−−−−−−−−−−IGFNVRYASDPYWGQKIAGIM−−−−−−−−−−YRADKFLGWKDWGKY                  
fig|360911.3.peg.477   Exiguobacterium sp. AT1b                                                                                                                                 DSP−−−−−−−YQFAS−−−IRTS−−SPYSAEEFDQYLTS−−−−−−−−−−−IDSPLAGE−−−−−−−−−−−−−−−−−−GKSFKRAEDTYNINGLFLLAVAGHESRFGTSDIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−REKRNLFGFRATDD−−−−D−−−−−−P−−−−−−SGN−−−−−−−−−−−−−−−−−−ATSFKTIDASVQAAAKLFATKYAT−−GPYARGDYPGNKQ−−−−−−−−−−−−−−−−−EGINIFYASDPYWGEKVAGTM−−−−−−−−−−YTIDRELGLKYLKK                   
fig|546269.3.peg.1159   Filifactor alocis ATCC 35896                                     MKNKKMISIGMFFVVFFCSTIFSFAETRTLLTKNGGEVNLFEKTEKIEKTVKKIDGTAQQTVTSNLSLEQKKIADNKLIADNSNIITCSDLGEDA−−−−−−−YNIINTDFLLKP−−SDVSEHFINNRL−−−−−−−−−−−−−QGTALEGL−−−−−−−−−−−−−−−−−−GGAFKRAEEKYGVNALFLVSLAMHESNVGRSRIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDKNNLFGFQAYDR−−−−S−−−−−−P−−−−−−YSS−−−−−−−−−−−−−−−−−−AGRFMSREACIDHVAGYISRNYLS                                                                                                
fig|546269.5.peg.244   Filifactor alocis ATCC 35896                                     MKNKKMISIGMFFVVFFCSTIFSFAETRTLLTKNGGEVNLFEKTEKIEKTVKKIDGTAQQTVTSNLSLEQKKIADNKLIADNSNIITCSDLGEDA−−−−−−−YNIINTDFLLKP−−SDVSEHFINNRL−−−−−−−−−−−−−QGTALEGL−−−−−−−−−−−−−−−−−−GGAFKRAEEKYGVNALFLVSLAMHESNVGRSRIA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDKNNLFGFQAYDR−−−−S−−−−−−P−−−−−−YSS−−−−−−−−−−−−−−−−−−AGRFMSREACIDHVAGYISRNYLS                                                                                                
fig|525255.3.peg.567   Anaerococcus tetradius ATCC 35098                                                                                     KDLEE−−−−−−−−−−−−−ALN−−−−−−−−−−−−−−−−IGCDNVNNDS−−−−−−−DF−−−−−YLLNN−−LNFSAKELDYGL−−−−−−−−−−−−−ADTGLAGL−−−−−−−−−−−−−−−−−−GKDFKAVADKYGINPLLLMAMAKHETGNGTSELF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−REKNNLFGFNAIDH−−−−D−−−−−−P−−−−−−YNM−−−−−−−−−−−−−−−−−−ATKFKRPKDSIDTVAKHLKEEYLDKNGTYFNGVSA−−−−−−−−−−−−−−−−−−−−−EGIGSSYASDPDWSKKVNSMMMEIADKM                                    
fig|525919.4.peg.730   Anaerococcus prevoti prevotii DSM 20548                                                                                 DKLDKDLDK−−−−−−−−−−−−−AIE−−−−−−−−−−−−−−−−IGCDNVNSKS−−−−−−−YF−−−−−YLLQD−−MPFTGSELDYGL−−−−−−−−−−−−−ADTGLYGL−−−−−−−−−−−−−−−−−−GQDFKDVSEKYGINPLLLMAMAKHETGNGTSDLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−REKNNLFGFNAIDH−−−−D−−−−−−P−−−−−−YNM−−−−−−−−−−−−−−−−−−ASKFKDPKDSIDTVAKHLKEEYLDKNGTYFNGVSA−−−−−−−−−−−−−−−−−−−−−KGIGTSYASDPEWSQKVNSMMIEIADEM                                    
fig|495036.3.peg.1972   Geobacillus sp. G11MC16                                                                                                                            TEVKTGAPLDGQRDGYQFID−−−LRTQ−−APVEAGQINKYIQSYVQSTG−−−−−KQSVLVNQ−−−−−−−−−−−−−−−−−−GQTFINVGRKYGVNPLYLAAHAIHESAFGTSRLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTKYNLFGYGAYDA−−−−A−−−−−−P−−−−−−FVS−−−−−−−−−−−−−−−−−−AYRFSSIEESIEYVARKIKSSYLNPSHPFFKGAFLGFRTNTLQNIRVDES−−−−−SEGMNFYYATDPYWGQTIARHMANMLSYDSNYYKSARI                           
fig|195103.9.peg.1391   Clostridium perfringens ATCC 13124                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|451756.6.peg.909   Clostridium perfringens CPE str. F4969                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|488537.5.peg.291   Clostridium perfringens D str. JGS1721                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|195102.1.peg.1294   Clostridium perfringens str. 13                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|451754.5.peg.1036   Clostridium perfringens B str. ATCC 3626                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIY−−−−−NGNGQ−−LVGYHIIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|451757.5.peg.1636   Clostridium perfringens NCTC 8239                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESRPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|451755.5.peg.1156   Clostridium perfringens E str. JGS1987                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSRLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESRPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|445334.5.peg.1939   Clostridium perfringens C str. JGS1495                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−YSEFEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSRLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESRPIY−−−−−NGNGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|289380.15.peg.1221   Clostridium perfringens SM101                                                                                          VSLNEYIKLQQRNNPSNYS−−−−−−HSELEKYINPAKATNK−−−−−−−−LQFLR−−−IDKFR−−SVNVSGLSSRL−−−−S−−−−−−−−NKGVLTGQ−−−−−−−−−−−−−−−−−−GQAFINAAKAFNIDPIYLVSQCLHETGNGTSKLAKGVTITEIADESRPIY−−−−−NGTGQ−−LVGYHMIKLSKPVTVYNLFGIGAKDN−−−−SSVFPNRALILGTTYAY−−−−−−−−−−−−−−−−−−NRGWTSIENAIKGAAEFVSLNYVHSSR−−−−−−−−−YSQNTLYKMRYNQN−−−−VSNIWHQYATTPWYAS−−−−SIADIMRSYQD                                  
fig|411484.7.peg.1420   Clostridium sp. SS2/1                                                                                              AEKKQHPTYGGKSIS−−−−−−TSTYTSYVDPSK−−−DT−−−−TNNFQFLT−−−LDTY−−REVDPTAYNNLLNSKLR−−−−−−−−SNSVLRNK−−−−−−−−−−−−−−−−−−GNVLIAAAKQYNIDPVYLLCQTILETGYGTSILSQGKAITTVVSGSSVVRDSSGNVTGFKTVNGKYITSTISKKMVYNLYGIKAYDS−−−−N−−−−−−PQLCGFSYAY−−−−−−−−−−−−−−−−−−YQGWTSVDAAIYGAAKYVSQDYIHNQT−−−−−−−−−YHQNTLYKFRYNPN−−−−INYLWHEYATDPSYAKQIATIMYDQFR                                      
fig|367459.5.peg.313   Clostridium difficile QCD-32g58                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFTNTT−−−−KGMMQFLK−−−INSYRDGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GAAFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVEATIDGSAKWISQNYVNSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|645463.3.peg.1223   Clostridium difficile R20291                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFTNTT−−−−KGMMQFLK−−−INSYRDGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GAAFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVEATIDGSAKWISQNYVNSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|479831.4.peg.460   Clostridium difficile QCD-63q42                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFTNTT−−−−KGMMQFLK−−−INSYRDGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GAAFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVEATIDGSAKWISQNYVNSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|1496.1.peg.3429   Clostridium difficile 630                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFTNTT−−−−KGMMQFLK−−−INSYRDGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GAAFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVETTIDGSAKWISQNYVNSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|272563.8.peg.1370   Clostridium difficile 630                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFTNTT−−−−KGMMQFLK−−−INSYRDGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GAAFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVETTIDGSAKWISQNYVNSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|499174.4.peg.587   Clostridium difficile QCD-23m63                                                                                                 SAQRTSSFVNAS−−−−−−SSDIEYYLNPKNFINTT−−−−KGMMQFLK−−−INSYRGGISESSLNSYLNGLS−−−−−−−−SSVFKNQ−−−−−−−−−−−−−−−−−−GATFINAAKKYNIDVVYLVSHAMWETAYGKSTLAQGQTLT−−−−−−−−−−−−−−−−−−−−−−−−SYKGQPLSKPVKVYNFFGIGAIDK−−−−S−−−−−−ANVSGAEAAY−−−−−−−−−−−−−−−−−−SNGWTSVEATIDGSAKWISQNYINSSK−−−−−−−−−YNQNTIYKMKW−−N−−−−YDYTWHQYATDVNWAN−−−−GISGIMEN                                     
fig|596329.3.peg.1291   Peptostreptococcus anaerobius 653-L                                                                              QDMNMSLSDHVNMQMSNALNVSNAPGWPRAT−−−−−−KEELTYLMDPNNFTDST−−−−−GMMQFVR−−−LDRFSNCISVDQLNSYINRYCP−−−−−−−−VGNPFHNQ−−−−−−−−−−−−−−−−−−GQAFINAAKKNNIDVIYLVAHSFIETGRGTSKLARGNVVN−−−−−−−−−−−−−−−−−−−−−−−−GK−−−−−−−−−TVYNFFGIGAVDG−−−−N−−−−−−AFAGGTATAY−−−−−−−−−−−−−−−−−−KNGWTSVAAGIDGAATWISNRYIHSGK−−−−−−−−−YDQNTLYKMKW−−S−−−−TTSIYHQYATAIQWPS−−−−HIGRVMSE                                     
fig|500633.7.peg.972   Clostridium hiranonis DSM 13275                                                                                                 MRKDTRAYGAPT−−−−−−KEELEYYLDPSNFTSYK−−−−DGIMQFVR−−−LDRYTDSITAKSLNNYFESRG−−−−−−−−SECIFNGK−−−−−−−−−−−−−−−−−−GQAFIDAAKKYNIDVLYFVSHAMWETGNGKSKLAQGQLVT−−−−−−−−−−−−−−−−−−−−−−−−SVDGVPLETPVTVYNFFGIGATDG−−−−N−−−−−−ALEGGKMTAY−−−−−−−−−−−−−−−−−−KNGWTTVEKGIDGAAKWISDGYIHNSK−−−−−−−−−YKQNTVYSMRW−−C−−−−YEYTWHQYATDVNWAN−−−−GISKMMSSLMTRYG                               
fig|445973.7.peg.2046   Clostridium bartlettii DSM 16795                                                           VGDVIINENLNYSFDAMVDYEYKLSQQGYNRIKANLSTNNQNSTKYLQAT−−−−−−REDLSKYLNPQTFSTNA−−−−NGRLQFLK−−−IDKYREGITASELNAFFNKYCK−−−−−−−−SNSVFINK−−−−−−−−−−−−−−−−−−GQAFVDAAKKHNLDVSYLVAASMVETGYGSSVLSQGVYVD−−−−−−−−−−−−−−−−−−−−−−−−GENG−−−−EKVKVYNFFGISAFDG−−−−T−−−−−−AVSSASQYAY−−−−−−−−−−−−−−−−−−KKGWTTVDKTIEGSAKWLSTNYIHSTK−−−−−−−−−YKQNTLYKMRW−−S−−−−YN−−TGHQYATDVSWAH−−−−IIAKVMNNIIPYYDN                              
fig|573061.4.peg.857   Clostridium cellulovorans 743B                                                                                                       RPA−−T−−−−−−RTEIYNEMNPNTSINDP−−−−NAVFMFMK−−−LNFTE−−GINADNLNKTL−−−−T−−−−−−−−TAGVLQGK−−−−−−−−−−−−−−−−−−GQAFLNGGRAFNVNPIYLVSHALLETGYGKSQLSIGTTITEIADLNSPVYETFLENGVKKEYLVGYKMIKLPAPVTVYNMYGIGAFDD−−−−MPHFPNRPLITGTTAAY−−−−−−−−−−−−−−−−−−KNGWTTVDAAITGGAKWIGDGYINDPT−−−−−−−−−FNQNTLYKMRW−−D−−−−FAKNWHQYATDVLWARKQTYNIAKLVNQM                                    
fig|663278.3.peg.1497   Ethanoligenens harbinense YUAN-3                                                                                                                        SSIDPNLLFADA−−−−VSKYEFMS−−−LYGM−−QGVTADDINEML−−−−T−−−−−−−−NCGVLTGQ−−−−−−−−−−−−−−−−−−GQAVVDAAARYNINPVYLAAHMRVETGNGTSTLAKGVQVTAGTYTDSYGRTVTVAA−−−−−−−−−−−−−−−−−SGTYYNLLGIHADDA−−−−S−−−−−−PVTDGSEYAA−−−−−−−−−−−−−−−−−−SQNWNTVAAAIAGGAQWISRNYINNSQLNTVSFSGYYDQPTLYEMKWDPEGTALHNARGSSEYATDEDWAFSIAKIMAQY                                        
fig|441771.4.peg.2828   Clostridium botulinum A str. Hall                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQAFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQSVVFNFDVPVYK                       
fig|441771.6.peg.2935   Clostridium botulinum A str. Hall                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQAFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQSVVFNFDVPVYK                       
fig|441770.6.peg.3046   Clostridium botulinum A str. ATCC 19397                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQAFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQSVVFNFDVPVYK                       
fig|441770.4.peg.2945   Clostridium botulinum A str. ATCC 19397                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQAFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQSVVFNFDVPVYK                       
fig|445335.4.peg.2140   Clostridium botulinum NCTC 2916                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|536232.3.peg.3347   Clostridium botulinum A2 str. Kyoto                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|515621.3.peg.3564   Clostridium botulinum Ba4 str. 657                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNSAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|498214.7.peg.3423   Clostridium botulinum A3 str. Loch Maree                                                                                        IKNGKKGYSTDINGVDWVQSDQQYDYIKSKVKEYMNPTNQIYDP−−−−IGQYQFLQ−−−LSYY−−ECTTVQQLNNAL−−−−K−−−−−−−−GKGVLEEK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISAGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|1232188.3.peg.2969   Clostridium botulinum CFSAN001628                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDS−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNNAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISSGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|441772.13.peg.3085   Clostridium botulinum F str. Langeland                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDS−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNNAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISSGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|758678.3.peg.3291   Clostridium botulinum F str. 230613                                                                                        IKNGKKGYSTDINGVNWVQSDQQYDYIKSKVKEYMNPTNQIYDS−−−−IGQYQFLQ−−−LSYY−−ECTTAQQLNNAL−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDAGKESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KTVYNLFGIGAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISSGYINNAT−−−−−−−−−YKQDTLYKMRWNPS−−−−−NPTVHQYATDVMWAYNQVGNIKKVIDQLQNVVFNFDVPVYK                       
fig|471871.7.peg.465   Clostridium sporogenes ATCC 15579                                    FTVIGEDGLIKNYKKTNYNITLDEMLNKQMDNRPAYHMYIPEKNTYEWRYAIVKNGKKGYSTDINGVNWVQSDQQYDYIKSRAREYIDPTNQIYDD−−−−IGQYQFLQ−−−LSYN−−ECTTAEQLNNML−−−−K−−−−−−−−GKGVLEGK−−−−−−−−−−−−−−−−−−GQVFIDTGRESNVSPIYLVAHALLETGNGTSTLAKGVVVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−KMVYNLFGINAVDS−−−−D−−−−−−PIGQGSKYAY−−−−−−−−−−−−−−−−−−EQGWFSVDLAIKGGAKWISSGYINNVT−−−−−−−−−YKQDTLYKMRWNPA−−−−−NPTVHQYATDVRWVYN                                                
fig|272562.1.peg.2470   Clostridium acetobutylicum ATCC 824                                     KLVGVDA−−−−−SSTKYNTSLSQLVDKQM−−−−−−−−−−−−−−−−−−−−−−−−−−QYGEPVTESGSSWVSAD−−−−−−RSTVQYYANPNNFLDS−−−−YGIYQFLV−−−LNYQ−−SGITVDEVNNML−−−−V−−−−−−−−GKGVLQGH−−−−−−−−−−−−−−−−−−GGAFLQSAQQNNISVFYLVSHALLETGNGTSALAKGMNVN−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−TIVYNMFGINALDS−−−−N−−−−−−PNYYGSQFAY−−−−−−−−−−−−−−−−−−KQGWTTVDKAIIGGASWIGSSYINNSS−−−−−−−−−YAQNTLYKMRWNPA−−−−−NPGTHQYATDVRWAYN                                                
fig|536227.3.peg.5020   Clostridium carboxidivorans P7                                                    NYDISVDQMVDIQTK−−−−−−−−−−−−−−−−−−−−−−−−−LSDKSVFVETNDFNNAAS−−−−−KNQIKYYLDPNNFMDS−−−−NGKYQFLK−−−LSYT−−DGMNVDQVNNIL−−−−K−−−−−−−−GKGILDGK−−−−−−−−−−−−−−−−−−GQAFLDAAKNNNISIVYLISHSLLETGNGASLLANGGQKD−−−−−SSGKYIFG−−−−−−−−−−−−−−−−−−−−−APVYNFFGIGAYDK−−−−D−−−−−−PNYYGTKAAY−−−−−−−−−−−−−−−−−−DNKWFTPEDAINGGAQWIASQYINNPN−−−−−−−−−GKQDTLYKMRWNPS−−−−−NPGEHQYATDVAWSYKQVPNMIKGITNILEQVKDIKLNF                         
fig|431943.4.peg.3768   Clostridium kluyveri DSM 555                                                        TLDDMVQKQFN−−−−−−−−−−−−−−−−−−−−−−−−−SYCKPVFVETNVMDNAAT−−−−−KNQIKYYVNPDNFLDG−−−−YGKYQFLK−−−LTYS−−EGITVDDLNSYL−−−−K−−−−−−−−GKGIFEGM−−−−−−−−−−−−−−−−−−GQAFLDAAKENNISVAYLVSHAMLETGYGTSKLATGGAVD−−−−−DSDNYVYG−−−−−−−−−−−−−−−−−−−−−EPVYNFFGIGATDD−−−−N−−−−−−PLINGTEKAY−−−−−−−−−−−−−−−−−−AEGWFTPEEALSGGAAWIASQYINNPE−−−−−−−−−KNQDTLYKMRWNPE−−−−−DPGEHQYATDIAWA                                                  
fig|386415.7.peg.2231   Clostridium novyi NT                                          KNPNEILKYTNYNKTISEATKNQL−−−−−−−−−−−−−−−−−−−−−−−−−−KDGDPKYSEGSNWIRSS−−−−−−ESLIKYYMDSNNFLDD−−−−LGKYQFLN−−−LNYM−−EGVTPKDLNNIL−−−−N−−−−−−−−GKGILEGK−−−−−−−−−−−−−−−−−−GETFLKAAKESNINPIYLVSHALLETGNGKSQLATGVLVS−−−−−SVD−−−−GKTVA−−−−−−−−−−−−−−−−PKKTYNMFGVRAVDN−−−−N−−−−−−ALKGGSEYAY−−−−−−−−−−−−−−−−−−KKGWFTPEEAIIGGAEFIGNGYINSPK−−−−−−−−−YKQNTLYKMRWNI−−−−−DVTWHQYCTDIGWGYKQLKRIKDLMEQCKDAKPVF                             
fig|445337.5.peg.2085   Clostridium botulinum C str. Eklund                                          KNPNEILKYTNYNKTISEATKNQM−−−−−−−−−−−−−−−−−−−−−−−−−−KDGDPKYSEGSNWIGSS−−−−−−ESLVKYYMDSNNFLDD−−−−LGKYQFLN−−−LNYM−−EGVTIENLNNIL−−−−R−−−−−−−−GKGILEGK−−−−−−−−−−−−−−−−−−GKAFLDGARKSNINPIYLVSHALLETGNGTSKLATGVLVN−−−−−SVD−−−−GKAVI−−−−−−−−−−−−−−−−PKKTYNMFGVRAVDN−−−−N−−−−−−ALKGGSEYAY−−−−−−−−−−−−−−−−−−KKGWFTPEDAIIGGAEFIGNGYINSSK−−−−−−−−−YKQNTLYKMRWNI−−−−−DVTWHQYCTDIGWGYKQLKRIKDLMEQCK                                   
fig|592027.3.peg.199   Clostridium botulinum D str. 1873                             VYFKVINKNIISDKKENETLTYTNYNKTFIDSIEDQI−−−−−−−−−−−−−−−−−−−−−−−−−−KNEQPVYSEGISWVQAS−−−−−−KALVEYYMNPNNFLDD−−−−LGKYQFLN−−−LNYM−−EGVTANDLNNIL−−−−K−−−−−−−−EKGILQNK−−−−−−−−−−−−−−−−−−GETFLKAAKIYNINPIYLVSHALLETGNGKSTLATGVLVK−−−−−SVK−−−−GKSVT−−−−−−−−−−−−−−−−PKKVYNMFGVRAVDI−−−−N−−−−−−PIKCGSEYAY−−−−−−−−−−−−−−−−−−TEKWFTPEEAILGGAKFIGNGYINSDK−−−−−−−−−YKQNTLYKMRWNI−−−−−NVSYHQYATDIGWAYKQLSRIRNFMSQCKSAKPVFDIPKFK                  &nb