(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004838

fig|518636.5.peg.4496   Clostridium asparagiforme DSM 15981     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICKVLSEILLSNILVISKKGKVLGVSLCSGVE−−−−−EIEELIEDQVGMYVDKMLNERLLSVLSTKENVNLA−−−−TLGFAEENV−−−−−RKYQAIITPIDIAGERLGTLFIY−−KQDSQYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKVQIVKSAISTLSFSELEAIIHIFEEL−−−−−−−−−−−−−−−DGS−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKAI
fig|457421.5.peg.1576   Clostridiales bacterium 1_7_47FAA     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICKVLSEILLSNILVISKKGKVLGVSINSDVD−−−−−EIEELIEDQVGGYVDKMLNERLLSVLSTKENVNLA−−−−TLGFAEENV−−−−−RKYQAIITPIDIAGERLGTLFIY−−KSDSQYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKVQIVKSAISTLSFSELEAIIHIFEEL−−−−−−−−−−−−−−−DGN−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKAI
fig|997895.4.peg.2074   Clostridium bolteae 90B3     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICKVLSEILLSNILVISKKGKVLGVSICSGVD−−−−−EIEELIEDQVGGYVDKMLNERLLSVLSTKENVNLA−−−−TLGFAEENV−−−−−RKYQAIITPIDIAGERLGTLFIY−−KSDSQYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKVQIVKSAISTLSFSELEAIIHIFEEL−−−−−−−−−−−−−−−DGN−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKTI
fig|411486.3.peg.259   Clostridium sp. M62/1     SVQLLDKTRKINKLLHNNHSH−−−−−−−−−KVVFNDICEVLSEILHSNILVISKKGKVLGVAICPGID−−−−−EIEELIEDQVGGFVDHMLNERLLNVLSTKENVNLA−−−−TLGFAEENV−−−−−KKYQAIITPIDMSGERLGTLFIY−−KSDEQYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKIQIVKSAISTLSFSELEAITHIFDEL−−−−−−−−−−−−−−−EGN−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKAL
fig|511680.4.peg.1947   Butyrivibrio crossotus DSM 2876     SVQLLDKTRKINRLLHNNSSQ−−−−−−−−−KVVFNDICKVMSEILSSDVLVVSRKGKLLGIANCDGVE−−−−−EIKELVQDKIGGFVDGMFNERMLNVLSTKENVNLE−−−−TLGFAEGYT−−−−−KKYHAIITPIDVAGERFGTLFIY−−KSDSQYEIDDIILCEYGATVVGLEMLRSSTEEQADLIRKEQVTKSAISTLTNTEIDAIKHVFSEL−−−−−−−−−−−−−−−KMGE−−−EQIIVTSRIADQQGVTRSIIVNALKKLESAGVIDARSSGMKGTKIKVLNDMIFDELANY
fig|515620.4.peg.745   Eubacterium eligens ATCC 27750     SVQLLDKTRKINKLLHNNHSH−−−−−−−−−RVDFNDICDVLSGILESNVLVISQKGKILGAGYWNNID−−−−−RIGELITADVGGFVDKMFNERLLGVLSTKENVNLL−−−−TLGFTSGSE−−−−−RKFNAIIAPVEIAGERLGTLFMY−−KCISDYEIDDIILCEYGATVVGLEMMSSVCNENAEDERKKKIVKSAISTLSASELQAIKAVFEAL−−−−−−−−−−−−−−−DGT−−−EGILVASRIADNTGITRSVIVNALKKFDSAGVISTKSSGMKGTKIKVLNEIVFDEIKKL
fig|483218.5.peg.1266   Bacteroides pectinophilus ATCC 43243         MDKTRKINKLLHNNHSQ−−−−−−−−−RVEFNDICAVLSGILESNILVISKKGKVLGTGFCDGVD−−−−−RIDELIFDKVGGFVDQMLNERLLSVLSTKENVNLA−−−−TLGFAEENV−−−−−RKFQALLAPIDIGGERLGTLFMY−−KSDNNYEIEDIILCEYGTTVVGLEMMRAVTDENAEEVRKQQIVKSAISTLSSSELEAIKHIFKEL−−−−−−−−−−−−−−−DGE−−−EGILVASKIADKVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVINDVVFDELKKL
fig|411469.3.peg.1293   Eubacterium hallii DSM 3353     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICEVLSNILLSNVLVISRKGKVLGIKNRQDIE−−−−−VIDELINNEVGGYIDSLLNERLLGVLSTKENVNLE−−−−TLGFEHTEI−−−−−DRYQAIITPIDIAGERLGTVFMY−−RKEHHYEIDDIILVEYGTTVVGLEMMRSVNEENAEETRKVSIVKSAISTLSFSELEAIQHIFDEL−−−−−−−−−−−−−−−DGS−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKKM
fig|357809.8.peg.2834   Clostridium phytofermentans ISDg     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICSVLSDILESNILVISKKGKVLGIKNRTDIT−−−−−PISELIKDSVGGYIDGMLNERLLNILSTKENVNLA−−−−TLGFEFDGV−−−−−NDYQAIITPIDIAGERLGTLFLY−−KNKDQYSIDDIILSEYGTTVVGLEMMRSVNEENAEENRKVHIVRSAISTLSFSELEAITHIFDEL−−−−−−−−−−−−−−−EGN−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELKKM
fig|592010.4.peg.1571   Abiotrophia defectiva ATCC 49176     SVQLLDKTRKINKLLHNNDSH−−−−−−−−−MVVFNDICGVLSEILDSNIMVLSKKGKVLGIKNRDDIP−−−−−AIKELIKDNVGGYIDGDLNERLLSILSTKENVNLT−−−−TLGFEFEGV−−−−−NDYQAIIIPIDIASDRFGTLFIY−−KVKAPYTIDDIILSEYGTTVVGLEIMRSVNEENAEESRKIQIVKSAVNTLSFSELEAITHILNEL−−−−−−−−−−−−−−−NGN−−−EGVLVASKVADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELTK 
fig|411474.6.peg.222   Coprococcus eutactus ATCC 27759     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICDVLSDILASNAMVISKKGKILGLKNREDIP−−−−−EIHELIEGKVGSLIDNMLNERLLLVLSTKENVNLT−−−−TLGFDGVDI−−−−−DKYHGLLLPIDIAGERLGTLFLY−−RLGTEYDIDDIILGEYGTTVVGLEMMRALNEENAEENRKIAIVRSAISTLSFSELQAIKHIFSEL−−−−−−−−−−−−−−−DGE−−−EGILVASKVADRVGITRSVIVNALRKFESAGVIEARSSGMKGTYIKVLNDVVFDELK  
fig|411489.7.peg.2437   Clostridium sp. L2-50     SVQLLDKTRKINKLLHNNNSH−−−−−−−−−KVVFNDICDVLSDILKSNVLVISKKGKVLGIKNREDIP−−−−−EIHELIEDKVGLLIDSMLNERLLLVLSTKENVNLT−−−−TLGFDSDNI−−−−−EKYQGLLLPIDIAGERLGTLFLY−−KLDAQYDIDDIILGEYGTTVVGLEMMRALNEENAEEDRKIAIVRSAISTLSFSELQAIKHIFSEL−−−−−−−−−−−−−−−DGK−−−EGILVASKVADRVGITRSVIVNALRKFESAGVIEARSSGMKGTYIKVLNDVVFDELK  
fig|718255.3.peg.2133   Roseburia intestinalis XB6B4     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICDVLKEILESNILVISKKGKVLGTGVLQGVE−−−−−EINELIVDEVGGFIDPLLNERLLGILSTKENVNLE−−−−TLGFVDDV−−−−−KKYTAIITPIDIAGERLGTLFVY−−RENRQYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKVQIVKSAISTLSFSELEAITHIFDEM−−−−−−−−−−−−−−−DGK−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELDKI
fig|622312.4.peg.855   Roseburia inulinivorans DSM 16841     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICDVLKDILNSNILVISKKGKVLGTGLTDGVE−−−−−EIRELIVDEVGGFIDPLLNERLLGILSTKENVNLE−−−−TLGFVNDI−−−−−KKYTAIITPIDIAGERLGTLFVY−−RENDPYDIDDIILSEYGTTVVGLEMMRSVNEENAEETRKVQIVKSAISTLSFSELEAITHIFEEM−−−−−−−−−−−−−−−DGK−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDVVFDELEQI
fig|657318.4.peg.1174   Eubacterium rectale DSM 17629      VQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICQVLTGVLDSDILVISKKGKVLGSSICKGVD−−−−−ELHELIVDEVGGYIDTELNERLLGILSTKENVNLE−−−−TLGFGEDT−−−−−RMYKAIITPIDIAGERLGTLFEY−−RSDREYDIDDIILTEYGTTVVGLEMMRSVNEENEEEKRKVAIVRSAINTLSYSELEAILHIFDEL−−−−−−−−−−−−−−−DGN−−−EGILVASRIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDVVFDELDRI
fig|478749.5.peg.359   Bryantella formatexigens DSM 14469     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICQVLTDILDSNILVISRKGKVLGVSLSDQVE−−−−−EIHELIADKVGGFIDPLLNERLLAVLSTKENVNLE−−−−TLGFVDGDV−−−−−GKYQAIINPIDIAGERLGTVFMY−−KCDSQYTIDDIILSEYGTTVVGLEMMRSVNEENAEENRKIQIVKSAISTLSYSELEAIIHIFDEL−−−−−−−−−−−−−−−NGN−−−EGILVASKVADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDVVFDELEEI
fig|537007.6.peg.1655   Blautia hansenii DSM 20583                                               ETLDSNILVMSKKGKVLGVGNCPGVD−−−−−RITELIDSEVGGYIDNLLNERLLGVLSTKENVNLQ−−−−TLGFEDEQI−−−−−SRYMAIISPIDIAGERLGTLFMY−−RSAKPYDIEDIIVSEYGTTVVGLEMMRSVHEENAEENRKIQVVKSAFSTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−NGE−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNEVIFDELEEI
fig|476272.5.peg.2421   Blautia hydrogenotrophica DSM 10507     SVQLLDKTRKINKLLHNSSSS−−−−−−−−−KVVFNDICQVLMETLSSNILVISKKGKVLGVSLCPGVE−−−−−ELTELIEDKVGGYIDHLLNERFLEVLSTKENVNLQ−−−−TLGFEASDI−−−−−QRYQGIINPIDIAGERLGTVFMY−−RNDKSYDIEDIIVSEYGTTVVGLEMMRSVHEENAEEDRKQQVVKSAFNTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−DGD−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNEVIFDELEEI
fig|457412.4.peg.1695   Ruminococcus sp. 5_1_39BFAA     SVQLLDRTRKINKLLHNSSSS−−−−−−−−−KVVFNDICQVLMETLSSNILVLSKKGKVLGVSLCPGVE−−−−−EITELIEDKVGGYVDSLLNERFLGVLSTKENVNLQ−−−−TLGFEHVS−−−−−−SSYQGIINPIDIAGERLGTVFMY−−RYEKPYDIEDIIVSEYGTTVVGLEMMRAVHEENAEEDRKQQVVKSAFNTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−DGD−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNEVIFDELEEI
fig|411459.7.peg.2862   Ruminococcus obeum ATCC 29174     SVQLLDKTRKINKLLHNSSSS−−−−−−−−−KVVFNDICQVLMDTLSSNILVLSKKGKVLGISLCPGVE−−−−−EITELIEDNVGGHVDSLLNERFLGVLSTKENVNLQ−−−−TLGFEHVN−−−−−−SNCQGIINPIDIAGERLGTVFMY−−RNDKPYDIEDIIVSEYGTTVVGLEMMRAVHEENAEEDRKQQVVKSAFNTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−DGE−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNEVIFDELEEI
fig|470146.3.peg.2970   Coprococcus comes ATCC 27758                                      FTDICEVLTEILASNVLVVSKKGKVLGVSTCEGVP−−−−−EIHELLQDEVGEHIDPMLNERLLSILSTKENVNLQ−−−−TLGFTADVS−−−−−QGYQAIITPINIAGERLGTLFLY−−RKESMYEIDDIILSEYGTTVVGLEMLRSVNEESAEETRKEQIVQSAISTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−NGM−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYVFKELDKI
fig|500632.7.peg.290   Clostridium nexile DSM 1787     SVQLLDKTRKINRLLHNNNSS−−−−−−−−−KVVFNDICEVLNEILASNVLVVSKKGKVLGSGQWKDVE−−−−−VIHELIDNEVGSHIDEMLNERLLSILSTKENVNLQ−−−−TLGFSPEVV−−−−−KGYQAIVTPIDIAGERLGTLFIY−−KKDELYEIDDIILSEYGTTVVGLEMLRSVNEESAEEIRKEQIVQSAISTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−EGT−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYIFEELDAI
fig|411460.6.peg.1796   Ruminococcus torques ATCC 27756     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICAVLTEILDSNVLVVSRKGKILGVSKSPDVQ−−−−−EISELITEAVGSHIDQMLNERLLSILSTKENVNLE−−−−TLGFSAEAV−−−−−QGCQAIVTPIDIAGERLGTLFIY−−KQDKTYSIDDIILSEYGTAVVGLEMLRSVNEESAEETRKEHIVQSAISTLSFSELEAIIHIFDEL−−−−−−−−−−−−−−−GGT−−−EGILVASKVADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDYIFEELEKI
fig|471875.6.peg.2373   Ruminococcus lactaris ATCC 29176     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICAVLTEILDSNVLVVSKKGKILGVSKCDHVR−−−−−EIHELITEAVGSHIDSMLNERLLSVLSTKENVNLE−−−−TLGFSADAV−−−−−EGCQAIITPIDIAGERLGTLFIY−−KQDATYSIDDIILSEYGTAVVGLEMLRSVNEESAEETRKEHVVQAAISTLSFSELEAIIHIFKEL−−−−−−−−−−−−−−−NGT−−−EGILVASKVADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDYVFTELERI
fig|658082.3.peg.3282   Lachnospiraceae bacterium 2_1_58FAA     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICAVLTEILNSNVLVVSKKGKILGVSKSAHVD−−−−−AINELIVESVGAHIDEMLNERLLNVLSTKENVNLE−−−−TLGFSSEKV−−−−−QGYQAIIVPIDIAGERLGTLFIY−−KQNELYSIDDIILSEYGTAVVGLEMLRSVNEESAEETRKEHIVQSAISTLSFSELEAIIHIFEEL−−−−−−−−−−−−−−−DGT−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVLNDYVFTELEKI
fig|411461.4.peg.816   Dorea formicigenerans ATCC 27755      VQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICDVLTEILESNVLVVSKKGKVLGKSRCLNVQ−−−−−PIGELIACEVGEHIDGMLNERLLSILSTKENVNLQ−−−−TLGFSAEAS−−−−−GGYQAIITPINIAGERLGTLFIY−−KVDKPYEIDDIILSEYGTTVVGLEMLRSVNEESAEETRKEHIVQSAISTLSYSELEAIIHIFDEL−−−−−−−−−−−−−−−DGS−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYVFTELEHI
fig|411462.6.peg.2331   Dorea longicatena DSM 13814      VQLLDKTRKINKLLHNNSSS−−−−−−−−−KVVFNDICEVLTEILDSNVLVISKKGKVLGGSKCEGVP−−−−−YITELIEREIGKHVDDMLNERLLSILSTKENVNLQ−−−−TLGFSEETV−−−−−KGYQAIITPIDIAGERLGTLFIY−−KKDKVYEIDDIILSEYGTTVVGLEMLRSVNEESAEETRKEHIVQSAISTLSYSELEAIIHIFDEL−−−−−−−−−−−−−−−DGA−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVINDYVFTELDRI
fig|553973.6.peg.389   Clostridium hylemonae DSM 15053        MLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICEVLTEILESNVLVVSKKGKILGGSRADGVP−−−−−VIKELIEQEVGKHIDEMLNERLLSILSTKENVNLQ−−−−TLGFSEDAV−−−−−RGYQAIITPIDIAGERLGTLFIY−−KNDEMYEIDDIILSEYGTTVVGLEMLRSVNEESAEETRKEHIVQSAISTLSYSELEAIIHIFEEL−−−−−−−−−−−−−−−DGT−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYVFTELERI
fig|658085.3.peg.1487   Lachnospiraceae bacterium 5_1_57FAA     SVQLLDKTRKINKLLHNNNSS−−−−−−−−−KVVFNDICEVLTEILDSNVLVVSKKGKVLGGSNCEGVP−−−−−IIKELLEREVGRHIDDMLNERLLSILSTKENVNLQ−−−−TLGFSEEAV−−−−−KGYQAIITPIDIAGERLGTLFIY−−KRDQMYEIDDIILSEYGTTVVGLEMLRSVNEESAEETRKEHIVQSAISTLSYSELEAIIHIFEEL−−−−−−−−−−−−−−−DGT−−−EGILVASKIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYVFTELEHI
fig|626523.3.peg.1068   Shuttleworthia satelles DSM 14600     SVELLDKTRKIGRLLHNNSSS−−−−−−−−−KVTFNDICLVLTDILESTALVISRKGKILGVRFGSGGE−−−−−ELTNDLSKEIGTFIEPILNERLLGILSTKENVNLE−−−−TLGITGDTI−−−−−PDCTAIVTPIDIAGERLGTMVVY−−RYHKSYGIDDIILSEYAGSVVGLEMMRAVTEENAAEARKEQVVKSAINTLSFSELEAIIHIFNEL−−−−−−−−−−−−−−−EGD−−−EGILVASRIADRVGITRSVIVNALRKFESAGVIESRSSGMKGTYIKVVNDYVFEALDKI
fig|411484.7.peg.452   Clostridium sp. SS2/1     SIQLLDKTRKINKLLHNNNSQ−−−−−−−−−KVVFNDICKVLTEVMNSNVLVISKKGKILGKNEAEHIE−−−−−VLHQLISGNVKDYVDFSLNERLLTILSTNENVSLS−−−−TLGFESDV−−−−−DDYYAIIAPIDIAGERFGTLFMY−−RQRENYSIDDIILAEYGTTVVGLEMLRSVSEEVEQERRKKGIVDSAISTLSFTEHKAVIHILEEL−−−−−−−−−−−−−−−EGN−−−EGVLVASKIADRFGITRSVVVNALRKLESAGVVETRSSGMKGTYIKVVNDFIFDEITKL
fig|411490.6.peg.1655   Anaerostipes caccae DSM 14662     SVQLLDKTRKINKLLHNNNSQ−−−−−−−−−KVVFNDICQVLMEVMDSNVIVISKKGKILGIQNSENID−−−−−PIEEMISGKIGDYIDTDLNERLLTILSTKENVNLQ−−−−TLGFESDI−−−−−HRYCGIISPIDIAGERFGTLFMY−−RMEDDYTIDDIILAEYGTTVVGLEMMRSVSEEMESERRKQNIIESAFRTLSFTELEAVHHIFDEL−−−−−−−−−−−−−−−NGS−−−EGILVASKIADRFGITRSVIVNALRKLESAGVIESRSSGMKGTYIKVVNDLIFDELNR 
fig|642492.3.peg.1499   Clostridium lentocellum DSM 5427     SQELLQKMRKVNRLLQRFGSD−−−−−−−−−RVIFSDICEVISDVVKANAMVVSTKSKVLGVN−−SGIP−−−−−−−HNFANEE−−NYIDYSVNDEFLTIMDIKEGVSLE−−−−SLFPAAANS−−−−−ANYTACIVPIIAAGQRLGTFVLYKEKSEASFNTEDFILAEYGATIVAVEMLTSLKDENDAEERRVAIVKSAIATLSYSELEAIFHIFEKL−−−−−−−−−−−−−−−DGS−−−EGLLIASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTYIKVLNSALLDELNKL
fig|351627.8.peg.1398   Caldicellulosiruptor saccharolyticus DSM 8903     QQSLLEKVRKINRIVQSKEKE−−−−−−−−−ILDFQKLCCVLGDVTDSSVFFIDANGKVFSKYLMPFVN−−−−−−VDLKLSEN−−ERLSPEIQKFLWSFVDTRVNLTLSEI−−ARVVEIESTKVDIKDVICAIIPIIGGTRRFGTVFSL−−KSYANFTEDDVILLEYVATIIGFDLLNLTKEEDEEEKKKREMIRSAIDTLSISELEALIHIFEEL−−−−−−−−−−−−−−−KTN−−−EGLLVASKIADRVGITRSVIVNALRKFESAGLIETRSLGLKGTYIKVLNDMVRSEIEKY
fig|521460.8.peg.2292   Anaerocellum thermophilum DSM 6725     QQSLLEKVRKLNRVIQSKDKE−−−−−−−−−VLDFEKLCSVVGDVTDSSVFFIDKDGKVICKYIMPFVN−−−−−−VDIKLSEE−−KKIGDNLQKFFWWFVDTRANMKFSDI−−TKIAEIESKVGSENDLLCTSVPVIGGGRRFGTVLAF−−KSFSSFTEEDIIVLEYASTVLGLELLNLSKEEDEEEKKKREMIKSAIETLSMSELEALVHIFDEL−−−−−−−−−−−−−−−KGN−−−EGLLVASRIADKVGITRSVIVNALRKFESAGLIETRSLGLKGTYIKVLNEMIRDEIEKQ
fig|643648.3.peg.984   Syntrophothermus lipocalidus DSM 12680                    QDEA−−−−−−−−−−−PVDFGQMAALIAQNIDCNVYIVGRRGRILGWSVEEDNG−−DFPEIEKLLDYV−−ERFPESFNRDFLNLSQPLINRRLGRK−−−CVFRMRRTACDCKGKVFTIIPVQGGRSRLATLVLY−−RREPEFSEEELVLGKVAALVIANEIMYLKSERQETVSQRKASLGAALAAISQSEREALYHLLSEL−−−−−−−−−−−−−−−KGK−−−EGVLVASHVADRVGLTRSVVASALRKFESAGIIESRSLGMKGTYIRLLVDNILDELR  
fig|335541.7.peg.893   Syntrophomonas wolfei subsp. wolfei str. Goettingen     SKSLLEKSRAINRILQKIAGH−−−−−−−−−PVNFFEIADVLCRNLECTVFIVGRRGQIGGYAFAEGAI−−−CQEIQQLIKHA−−ERFPESFNQELLNILETQTNIILKDGRKCLFNPDNVNCSCSARIWSITPVFGGARRIGTLIFM−−RDKVKFTEEDIVLIEYGAMVMANEIMRIRTERIEEEARKKASVQIALATLSYSEKEAIDHIIAEL−−−−−−−−−−−−−−−KGK−−−EGLLVASRIADKVGITRSVIVSALRKFESAGVIESRSLGMKGTYIKVLNDYLFEELRNQ
fig|485916.5.peg.1236   Desulfotomaculum acetoxidans DSM 771     MRALLEKTRSINRLLQKSAGY−−−−−−−−−PVDFKEIAASLSDNLGCSVYIIDRRGKPLGHSYLQGFT−−−CEIMVDIVEAK−−ESFPTEYNDNLLQLTETHSNFCQTAN−−ACVFDYECRCKFNNKVSTVVPIVGAGSRLGTLVLA−−KINENFNDEDLVLAEYGATVVGMEILRARADRMEEEARKRAAVQVALGTLSYSELDAVQHIFEQL−−−−−−−−−−−−−−−GGE−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTYIRVLNDRLLDELARL
fig|370438.4.peg.1407   Pelotomaculum thermopropionicum SI     MRALLDKTRAINRLLQKSAGH−−−−−−−−−IVDFNEVANVLSENIGASIYILDRRGKVLGHAYLKGWT−−−CDVMKDIVEGC−−GGFPEEYNEYLMKINETFANFCQTAN−−ACLFEEKRCRFDNKITTIVPIVGAGTRLGTLILA−−KFDNHFTEEDLILGEYGATVVGMEILRARAEKMEEEARKRAAVQVAIGTLSYSELDAVQHIFEQL−−−−−−−−−−−−−−−EGE−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIRVLNDCLLEELGRL
fig|477974.6.peg.631   Desulforudis audaxviator MP104C       TLLEKCRAINRILQKSAGY−−−−−−−−−AVDYGEVAQVLCANLRANAYILDEEGRILGAEFLDDFS−−−CGVVRSMIYES−−GFPREYNEWLLGIPSTYANFCQTEN−−ACVFNAYEHCQYVNKVTTVVPIVGAGKRLGTLVLA−−KFGEEFTGDDLVLAEIGATVVGMEILRAQVGRMEEDVRKRTAVQVALGTLSYSELDAVRHIFRQL−−−−−−−−−−−−−−−DGS−−−EGLLVASKIADRAGITRSVIVNALRKFESAGVIESKSLGMKGTYIRVLNDRLLDELAKM
fig|349161.6.peg.2170   Desulfotomaculum reducens MI-1     MKTLLERTRTINKLLQKSAGY−−−−−−−−−PVDFGEIADVLSENIEANCYIIDRRGRALGYKFMPEFA−−−CDIMKDIVEGS−−KRFPEEYNEGLLGVSETHANFCQTYD−−ACVFFEEEKCKGQNKVTTVVPIVGAGSRLGTLVLA−−KFNQNFTDEDLILAEYGATVVAMEILRARAGRMEEEARKKAAVQIALGTLSYSELDAVQHIFEQL−−−−−−−−−−−−−−−EGD−−−EGVLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIRVLNDRLIEELQRL
fig|246194.6.peg.1708   Carboxydothermus hydrogenoformans Z-2901     MRTLLEKTRSINRILQKAAGN−−−−−−−−−PVDFEEIAQVLSENINCNVYIVSRKGKILGHAFFKNFT−−−CDIMRQVVEET−−ERFPEDYNENFLLKITETHANFCQKAN−−ACVFFQDVQCISQNKVMTVVPIVGGGVRLGTLVLA−−KFDESFTDGDLVLAEYGATVIGMEILRAQAEKVEEEARKKAAVQIALATLSYSELDAIKHIFEEL−−−−−−−−−−−−−−−EGD−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIKVLNDHLFEELEKL
fig|635013.3.peg.1654   Thermincola sp. JR     MRNLLEKTRCINKLLQKAAGH−−−−−−−−−PVDFQEMADVLTENIRANTYIIGRRGKILGCAFMDNFA−−−CQTMKDLIESS−−DRFPEAYNESLLRVNETRANFQQKDN−−VCVFDDAQECVFTEKVMTIVPVVGGGERLGTLLLA−−KSDENFTDEDLVLAEYGATVVGMEILRIKAERVEEEARKKAAVQIALGTLSYSELEAIEHIFDEL−−−−−−−−−−−−−−−EGD−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIRILNERLLDELQKL
fig|872024.4.peg.28   Desulfitobacterium hafniense TCP-A     MKNLLEKTRAISKLIQKAAGH−−−−−−−−−SVDFDEMANVLSESIQSNCYIVGRRGKILGYSFMQNFG−−−CNTMEDIVVHT−−ERFPESYNEGLLKVTETRSNTTQVAN−−GCVFNEKERCHFNNKITTILPILGGGERVGTLVLA−−KFDQDFSEADLILAEYGATVVGMEILRIKAERAEEEARKKAAVQIAVGTLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−GGG−−−DGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIRVLNDYLLEELDKI
fig|498761.3.peg.2003   Heliobacterium modesticaldum Ice1     MRTLLEKTRTVNRLIQKSAGH−−−−−−−−−PVNFEEMAKITSELINANCYIIGRRGKILGFNFMPHFA−−−CDIMADIVHHT−−ERFPECYNQDLLRINETQANFSQVSN−−ACVFNYGETCSHGHKLMTVIPILGGGQRLGTLVLA−−KYNEEFTDEDLILAEYAATVVGMEILRAKAERMEEEARKKAAVQIAIGTLSYSELEAVEHIFSEL−−−−−−−−−−−−−−−EGN−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIRILNDNLMEELEKL
fig|264732.9.peg.1013   Moorella thermoacetica ATCC 39073     METLLERSRKINRLLQRAAGN−−−−−−−−−PVDFQEMASVMRDVLGANVYIVGRHARVLGYAFVEGFT−−−CDIMEEIVFQS−−ERFPEQYNEQLLRIDETQANFCQVGN−−GCVFDMDKKCVFNNKLTTVVPIIGGGQRLGTLVLS−−KFNVRFDDEDLVLAEYGATVVGMEILRAKADKIEDEARKRAAVHVALATLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−DGD−−−EGILVASKIADRAGITRSVIVNALRKFESAGVIESKSLGMKGTYIRVLNDHLLEELEKL
fig|568816.4.peg.1134   Acidaminococcus intestini RyC-MR95     MLALLEKTRMINKLLQNT−−E−−−−−−−−−VISYKKMAEVLKDVIKANIYIVSSEGELLGYSILDGFE−−−CELMIKKVLDV−−GRFPENYVKWLEQIRETSSNYRLVKN−−MCAFSDDTKCLFESKYTTVVPIFGNGVRLGTLILG−−KFKKEFIDSDLLLSEYAATVIGMQLLHDKAVHIEEASRKKAMVQIAFSNLSYSELEAISEILKAL−−−−−−−−−−−−−−−PGD−−−EGLLVASKIADQAGITRSVIVNALRKFESAGVLETESLGMKGTYVRILNEYLRDGLKEH
fig|591001.3.peg.1220   Acidaminococcus fermentans DSM 20731     MLPLLEKTRMINKLLQNT−−E−−−−−−−−−TVSYKKMAEVLKDVIKANIYIVSSEGELLGYSILDGFE−−−CELMIKKVLDV−−GKFPADYVKWLEGIRETSSNYRLVKN−−MCAFSEGTKCLFESKYTTVVPIFGNGVRLGTLILG−−KFKKEFVDSDLLLSEYAATVIGMQLLHDKAMHIEEASRKKAMVQIAFSNLSYSELEAISEILKAL−−−−−−−−−−−−−−−PGD−−−EGLLVASKIADQAGITRSVIVNALRKFESAGVLETESLGMKGTYVRILNEYLRDGLKEH
fig|401526.3.peg.552   Thermosinus carboxydivorans Nor1     MLSLLDRTRKINKLLQKA−−E−−−−−−−−−KVQYDDISSVLSNVMSANVYIVSKEGAVLGYALIDDFE−−−CDLMRDKVLKQ−−GYFPERYVEWLLKISETSPNLRLESG−−MCAFSEGTVCMFNDKFTTIVPIHGGGERIGTLIVA−−KFHVEFTDDDLILAEYGATVVGMEILRDRSDKIEEEARKKATVQVALGTLSYSELEAVMHILGEL−−−−−−−−−−−−−−−EGN−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESKSLGMKGTYIKVLNDRLLDELKKM
fig|546271.3.peg.157   Selenomonas sputigena ATCC 35185     MATLLEKTRKINRLLQRA−−E−−−−−−−−−SVEYDSISRVLSAVIDANVYIVNKAGKIFGHAFIDDFE−−−CDLMLANVVQQ−−GNFPKRYVSWLLKMDETSPNLKSKTG−−ICAFTEDTDCRFEGKNTTIVPIYGVGDRIGTLIIA−−KYDTDFTEADLILAEYGATVVGMEMLRDRTQQIEIEARKKATVQIALATLSFSEVKAAKSIFAEL−−−−−−−−−−−−−−−EGS−−−EGLLVASKIADRAKITRSVIVNALRKFESAGLIQSKSLGMKGTHIKVLNPYLLEELQR 
fig|500635.8.peg.1493   Mitsuokella multacida DSM 20544     MASLLEKTRKINRLLQRS−−E−−−−−−−−−NVEYDGISRVLSNVLNANVYITNKKGKIYGYAFVDDFE−−−CDLMIDKVIDQ−−GEFPKHYVSWLMRMDETCANLRSKTG−−MCAYEENTKCLFNGKNTTIVPIYGVGERIGTLIVA−−KYDEEFDDDDLLLCEYGATVVGMEMLRDHAEKIEIEARKKATVQIAINTLSFSERKAAFAILSAL−−−−−−−−−−−−−−−DST−−−EGLLVASKIADQVKITRSVIVNALRKFESAGVISSKSLGMKGTYIKVLNEYLLDKVQKL
fig|585503.3.peg.751   Selenomonas noxia ATCC 43541     MISLLGKTRQINRLLQRSE−−−−−−−−−−−SVEYDGISRVLSNVLEANVYITDERGKICGYAFFDDD−−−−DLMVNEAIEL−−GQFPRKYVDWLNRLEETHANIRMDAE−−GASYEQEMVELFRGQNIVITPIYGPRRRLGTLVVA−−SSKKEFGDPDLLLCEYGATVVGMEMLRDASQRNEIEARQREAVRIAVETLSYSERKAAHAILQEL−−−−−−−−−−−−−−−ASQGKFEGRLIASRIADEAKITRSVIVNALRKFESAGVIESKSLGMKGTFVRVTNAYLMEKLPEL
fig|638302.3.peg.371   Selenomonas flueggei ATCC 43531     MITLLGKTRQINRLLQRSE−−−−−−−−−−−SVEYDGISRVLSNVLEANVYITDEGGRICGYAFYDDDD−−−−DLMTNEAIEL−−GQFPRKFVDWLNRLEETRSNIRVGAD−−GASFEKEMATLFHDQNIVVTPIYGPRRRLGTLVVA−−SGRKEFGDPDLLLSEYGATVVGMEMLRDTAQKSEIEARQREAVRIAVETLSYSERKAAHAILQEL−−−−−−−−−−−−−−−ASQGKFEGRLIASRIADEAKITRSVIVNALRKFESAGVIESKSLGMKGTFVRVTNSYLMEKLPEL
fig|373903.4.peg.812   Halothermothrix orenii H 168     MDQLLEKSRKINRLLQRTGGK−−−−−−−−−PVDFKEMAQVLKEAIKCNIYIASKKGKILGYSLLSDFE−−−CDIMEEEVIEK−−GHFPEDYNEGLMRVQETRANIKQKQG−−NCVFTDGEECLFQNKLTTIVPVIGGGDRLGTLVLA−−RYDEEFTDHDLVLAEYGSSVVGMEILRSRSEKIEKEARKKAAVQIAIDTLSYSELEAIEHIFEEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTYIKILNDYLLDELEKL
fig|555088.4.peg.2345   Dethiobacter alkaliphilus AHT 1     MTNLLEKSRRINKILQKTAGQ−−−−−−−−−HVDFKEVADVLKNVIHANIYIADRGGKILGYSLVDEFE−−−CELMVTEVLKD−−GVFPDDYNQQLLGVDESRVNLRQKVN−−DCVFIDDTECLFTNKITTIVPIIGGGKRLGTLLLA−−RFAKEFDPEDLILAEYGATVVGMEILRSKAEKIEEEARNKAVVQLAIGTLSYSEMEAVEHIFEEL−−−−−−−−−−−−−−−NGD−−−EGLLVASKIADQLGITRSVIVNALRKFESAGVIESRSLGMKGTYIKVKNPYLLDQLAKR
fig|457570.14.peg.1421   Natranaerobius thermophilus JW/NM-WN-LF     SSSLLEKTRRINRILQKAAGQ−−−−−−−−−PVDFAEVAQVLRDVIEANTYIASKKGKILGSALVDEFE−−−CEIMKDQVLDQ−−GKFPEDYNDYLLSLNETSYNLTQKRN−−ECVYKNDEQCLFENKLTTVVPIIGGGKRLGSLILA−−RFSKEFQDEDLILAENGATVVGMEILRAKAEEIEEEARNKAIVQLALGTLSYSELEAVEHIFEEL−−−−−−−−−−−−−−−DGD−−−EGLLVASKVADRVGITRSVIVNALRKFESAGVIESRSLGMKGTYIKVLNNQLLEELRKR
fig|457570.7.peg.1399   Natranaerobius thermophilus JW/NM-WN-LF     SSSLLEKTRRINRILQKAAGQ−−−−−−−−−PVDFAEVAQVLRDVIEANTYIASKKGKILGSALVDEFE−−−CEIMKDQVLDQ−−GKFPEDYNDYLLSLNETSYNLTQKRN−−ECVYKNDEQCLFENKLTTVVPIIGGGKRLGSLILA−−RFSKEFQDEDLILAENGATVVGMEILRAKAEEIEEEARNKAIVQLALGTLSYSELEAVEHIFEEL−−−−−−−−−−−−−−−DGD−−−EGLLVASKVADRVGITRSVIVNALRKFESAGVIESRSLGMKGTYIKVLNNQLLEELRKR
fig|469381.5.peg.295   Dethiosulfovibrio peptidovorans DSM 11002     MQDLLEKTRLVGRALQSRREG−−−−−−−−TKPDYSKLARLLGEFSTANVYILSRDGQILGHSWVSEYH−−−SEAIASFLET−−−GYMPESFIER−−−−LNQQRESLMSKSDAYM−−FDDPEEKSSEPEKDALFVPIYGAAERLGTLMLV−−RFAETFRTKDFVLAEYLATLVGIEILHERTKIIEERARERLVVQMAMRALSYSEVESIKHIIKEL−−−−−−−−−−−−−−−NAF−−−EGVVIASKVADRVGVTRSVIVNALRKLESAGIIESRSLGMKGTFIKILSPLFIEEL   
fig|352165.3.peg.797   Pyramidobacter piscolens W5455     MHELLEKTRQVGRAMQGRREG−−−−−−−−TRPDYNKLARLLCEFSTANVYVLSREGQILGYAWVNEYH−−−SEAIASFIEQ−−−GYMPESFVEK−−−−LSQQRETVLSKADGAL−−FDDQAESVA−−DKTALYVPIYGASERLGTLVLA−−RFASNFSTQDLVLAEYLATLVGIEILHDRSRQIEELARERLVVNMAMKALSYSEIDAINHIITRLKELSAEKNAGFRKENNEC−−−EGVVIASKIADHVGVTRSVIVNALRKLESAGIIESRSLGMKGTFIKVLSPLFVDELA  
fig|572547.3.peg.1569   Aminobacterium colombiense DSM 12261     MKDLLDKTRQVGRALQSRREG−−−−−−−−TKPDYSKLAKLLCEFSTANVYIINREGRILVHSWVSEYH−−−SEAVANFLER−−−GYMPESFVEK−−−−MNQHRESILSETDGYL−−FDDEVASKEAPEKHLLYVPIYSAAERLGTLLLV−−RFFNPFYMKDLILAEYLATLVGIEILHDRTRSIEERARERLVVQMAMRALSYSEVESVKHIIAEL−−−−−−−−−−−−−−−GTY−−−EGVVIASKVADRVGVTRSVIVNALRKLESAGIIESRSLGMKGTFIKILSPLFIEEL   
fig|645512.3.peg.685   Jonquetella anthropi E3_33 E1     MDELLATTRLVNRTMQGRREG−−−−−−−−ETLDYSKLAKALGTFSTANAYLIGCDGRVLGYSWQEGYS−−−SKVLETSFRQ−−−GIMPESLVER−−−−VNHQRETVVSHADAYL−−FDDAAQNPS−−EKTALFVPIYGGAERLGTLILS−−RLGAEFSTKDLVLAEYLATIVGLEILHDRGRQIEEEGRERLIVQMAMRALSYSEVQSIRHIIEEL−−−−−−−−−−−−−−−DGF−−−EGVVVASRVADRVGVTRSVIVNAFRKLESAGIIESRSLGMKGTHLRILSPLFVSEL   
fig|525903.6.peg.1342   Thermanaerovibrio acidaminovorans DSM 6589     MQDLLEKTRLVARALQNRKDR−−−−−−−−GAPDYSKLSRLLCDLSAANVYIVSRDGRILGYAWISSYD−−−CPIMVDILSS−−−NTLPSGYMDR−−−−LNQYHESVLNHTDNGMCAYTDQPCTYS−−NKHVLYVPINGGGDRLGTLILA−−RFGCPFDTRDLVLAEYLATVVGLEILHDRSRSIEERGRERLVVQMAMRALSYSEVESVRHIIQDL−−−−−−−−−−−−−−−GGS−−−EGVVVASKVADRVGVTRSVIVNALRKLSSAGIIESRSLGMKGTYIKVISSLFLEEL   
fig|592015.5.peg.214   Anaerobaculum hydrogeniformans ATCC BAA-1850     MEDLLNKTRIISRTLQSSAMT−−−−−−−−PHPDYQKIARLLCDLATANVYIINGEGKILGYAWISDYK−−−CDYMEQLLNE−−−GYMPKNYTER−−−−LNQHSESVLNHSDHGNCAYADEPCRYF−−NKHVVYVPIFSCGERLGTLILA−−RFGAPFDTRDLVLSEYLATVVGIEILYDRTHHIEERAKERFMVQIAVRALSYSEMESIKVILKEL−−−−−−−−−−−−−−−GGY−−−EGVVVASRVADRIGVTRSVIVNALRKLESAGLIESRSLGMKGTYIKILSPIFLEELSK 
fig|246194.6.peg.137   Carboxydothermus hydrogenoformans Z-2901     MLSLLEKTRLLNRFIQRSPQR−−−−−−−−−PEPFMELAEMLGDISNASVYIIGRRKILGYYERLDLV−−−GLVIYGRDLEA−−RQVEQDFQDWLFSFNQTDHNIKGE−−−−−−−−−−−−−−−−−−DGLTYTVVPVFGGGERQGTILLV−−KKGQEEFNAQDLILYEYAATVVGLEILRLNSEKMEEEARKKAAVRLALDALSYSELEAVKKIFSEL−−−−−−−−−−−−−−−DGV−−−EGFVVASKLAEQYHLTRSVIVNALRKLESAGVIDSRSLGMKGTYIRILNDYFLDKLE  
fig|445971.6.peg.2232   Anaerofustis stercorihominis DSM 17244        LLDKIRKLNEILKLTATD−−−−−−−−−VVSFDALTEELSNILNVNVYVSENDGTILAYSTSDRFK−−−CGLTYSSHEE−−−THFPDNFNNKLLSYNDTVENEYDESP−−ICTFGDQGPCVYKDRYLTIVPINGLGERMGTLLFS−−KYGGKFNDDEIILCEYSAAIVVMELLRYVQDQRKKNDADVAAAKMALSTLSYSEVEAVRMIFKEV−−−−−−−−−−−−−−−−−KD−−−EGLVVASKIATEAQITRSVVSNALRKLESAGIIETRSLGMKGTYIKILNQELRSQLN  
fig|562970.4.peg.2480   Bacillus tusciae DSM 2912     MGTMLEKVHRMNVLLQKSAAE−−−−−−−−−SIDFKEMSELLSETLRANVYVVSKSGKILGYGMAEYAL−−−TAEWERIMNVD−−GRFPGAFNDTLLSFSETAVNLQNKEK−−LYVFSEEENETFRQKNIMIVPVVGGGERLGTMLLA−−RLDRKFTDEDIILAEYAATIVAMEILRAKQIQRQEEARKRMMAQLAFDNLSYSEVQAVMSIMNAL−−−−−−−−−−−−−−−KGD−−−DGVIVASRVADEGGITRSVVVNAVRKLQSAGLVDSRSLGMKGTYLRILNPFLRDVLRK 
fig|543302.3.peg.641   Alicyclobacillus acidocaldarius LAA1       SLLEQVQELGQLLHRSNE−−−−−−−−−QVEFQEVAEFLSRLMQSNVYIVGRKGKILGYGVAEHEL−−−TEEWLNIMTRE−−QRFPGDFNKHLLRIEQTIANLTDEQKKPLYVFSPEENESFRSKHLMITPIIGARERQGTLLFA−−RSQRPFNEDDQVLAEYAATVVALEIVHSRQQQKEEESRQRALAHLAVESLSFSELQAAKYLLDAV−−−−−−−−−−−−−−−RNSP−−EGIVVSSQIADQHGVTRSVIVNSIRKLESAGTIESRSLGMKGTHLRILNPYVEEEINRQ
fig|521098.5.peg.2348   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     IVSLLEQVQELGQLLHRSNE−−−−−−−−−QVEFQEVAEFLSRLMQSNVYIVGRKGKILGYGVAEHEL−−−TEEWLNIMTRE−−QRFPGDFNKHLLRIEQTIANLTDEQKKPLYVFSPEENESFRSKHLMITPIIGARERQGTLLFA−−RSQRPFNEDDQILAEYAATVVALEIVHSRHQQKEEESRQRALAHLAVESLSFSELQAAKYLLDAV−−−−−−−−−−−−−−−RNSP−−EGIVVSSQIADQHGVTRSVIVNSIRKLESAGTIESRSLGMKGTHLRILNPYVEEEINRQ
fig|441770.4.peg.2144   Clostridium botulinum A str. ATCC 19397     MSSLLDKTRMLNRILQKSGTE−−−−−−−−−PVDFEDICDLLSDVLACNVYIISRKGKILGSKFYSGFE−−−CDEVREVVLKE−−NRFPDFYNNKLLNVNETLSNSPNHD−−KCVFDNLKDCSINNKLSTIVPINGNRERLGTLLLA−−RFDKEFTDEDLVLAEYSATIIGLEILRSKQDQIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGT−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLLEELKKI
fig|471871.7.peg.1197   Clostridium sporogenes ATCC 15579     MSSLLDKTRMLNRILQKSGTE−−−−−−−−−PVDFEDICDLLSDVLECNVYIISRKGKILGSKFYSGFE−−−CDEVREVVLKE−−NRFPDFYNNKLLNVNETLSNSPNHD−−KCVFDNLKDCSINNKLSTIVPINGNRERLGTLLLA−−RFDKEFTDEDLVLAEYSATIIGLEILRSKQDQIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGT−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLLEELKKI
fig|498214.7.peg.2727   Clostridium botulinum A3 str. Loch Maree     MSSLLDKTRMLNRILQKSGTE−−−−−−−−−PVDFEDICDLLSDVLACNVYIISRKGKILGSKFYSGFE−−−CEEVREVVLKE−−NRFPDFYNNKLLNVNETLSNSPNHD−−KCVFDNLKDCSINNKLSTIVPINGNRERLGTLLLA−−RFDKEFTDEDLILAEYSATIIGLEILRSKQDQIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGT−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLLEELKKI
fig|212717.8.peg.1284   Clostridium tetani E88     MSSLLEKTRQLNKILQKSGAE−−−−−−−−−PVVFDDICNLLSEVLSCNVYIISKKGKILGYDLSTGFE−−−CQTVRDKVVPE−−KRFPEHYNNKLLNVHGTKSNLENQG−−ECVFESGEDCGVKNKLTTIVPINGNRERLGTLLLA−−RFDVPFTDDDLIISEYSATIIGLEILRSKQDEIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGP−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDRLLEELKKI
fig|536227.4.peg.756   Clostridium carboxidivorans P7     MTSLLNKTRMLNKILQKSGTE−−−−−−−−−PVVFDDICNLLSEVLSCNVYIISRKGKVLGYNFSTGFE−−−CETVKEKVLSE−−MRFPEGYNNKLLNIHETLSNLTNHG−−ICVYDESEPCAIKNKLTTIVPINGNRERLGTLMLA−−RFDENFTDEDLILSEYSATIIGLEILRAKHDEIE                                                                                                                
fig|536227.3.peg.1172   Clostridium carboxidivorans P7     MTSLLNKTRMLNKILQKSGTE−−−−−−−−−PVVFDDICNLLSEVLSCNVYIISRKGKVLGYNFSTGFE−−−CETVKEKVLSE−−MRFPEGYNNKLLNIHETLSNLTNHG−−ICVYDESEPCAIKNKLTTIVPINGNRERLGTLMLA−−RFDENFTDEDLILSEYSATIIGLEILRAKHDEIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGS−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNEKLLDELKKI
fig|431943.8.peg.1479   Clostridium kluyveri DSM 555     MSTLLDKTRKLNKILQKSGVE−−−−−−−−−PVVFDDICKILSEVLGCNVYVISRKGKVLGYNFPDGFE−−−CSTVKNKIISE−−MRFPEQYNNKLLNAHETLPNLSNHG−−ICVFEDGTPCDLEDKVTTIVPIIGNRERLGTLLLA−−SFGEKFTDEDLVLGEYSATIVGLEILKSKNDEIEEEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDKLLDELKKI
fig|863638.3.peg.1832   Clostridium acetobutylicum EA 2018     MSILLNKTRKLNTILQKSGTE−−−−−−−−−PVIFDDICNILSEVLECNVYVVSRKGKILGNNFSSGFE−−−CEKLKKEIIPT−−KKFPDSYNLKLLDCKETKANLKHTE−−FCTFYENEKCEFENKVSTIVPIIGNRERLGTLVLA−−RFTKKFTDDDLVLAEYSATIVGLEILRSKNDEIEAEARKRAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDRLLEGLKKI
fig|592027.3.peg.1090   Clostridium botulinum D str. 1873      SELLTKIRRLNKIIQKTGAE−−−−−−−−−PVVFDDICGSLSEVLECNVYIISRKGKILGHRFFNGVE−−−CESVKEKVVSE−−RKFPEKFNSKLLGINETISNVQNDG−−KSSFDEKKPAEMEGKLSTIVPIVGNRERLGTLFLT−−RFEGLFSDEDLILAEYSATIVGLEILRAKNDKMEDEARKKAVVQLAIGTLSYSELEAVEHVFNEL−−−−−−−−−−−−−−−DGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDKLLDELKKI
fig|386415.6.peg.1255   Clostridium novyi NT      SELLTKIRRLNKIIQKTGAE−−−−−−−−−PVVFDDICHSLSEVLECNVYIISRKGKILGHRFFNGVE−−−CESIKEKVVSE−−RKFPEKFNSKLLSINETISNIENNG−−KSSFDEKKPAEMEGKLSTIVPIVGNRERLGTLFLT−−RFEGLFSDEDLILSEYSATIVGLEILRAKNDALEDEARKKAVVQLAIGTLSYSELEAVEHVFNEL−−−−−−−−−−−−−−−DGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDKLLDELKKI
fig|445337.5.peg.2676   Clostridium botulinum C str. Eklund      SELLTKIRRLNKIIQKTGAE−−−−−−−−−PVVFDDICHSLSEVLECNVYIISRKGKILGHRFFNGVE−−−CESIKEKVVSE−−RKFPEKFNSKLLSISETISNIENNG−−KSSFDEKKPAEMEGKLSTIVPIVGNRERLGTLFLT−−RFEGLFSDEDLILAEYSATIVGLEILRAKNDELEDEARKKAVVQLAIGTLSYSELEAVEHVFNEL−−−−−−−−−−−−−−−DGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDKLLDELKKI
fig|573061.4.peg.4073   Clostridium cellulovorans 743B     MQSLLSRTRMLNKILQKSGTE−−−−−−−−−PVEFDEICELLSRVLDCNVYIVSRKGKVLGHSFATNFE−−−ISPVEEKVLED−−GRFSEAYNNKLLNIQETKANLSSKD−−QFVFEEVSLCYLKDKLFTVVPIMGNRERLGTLLMI−−KAQEEFTEEELILCEYSSTIVGLEILRSKQDEIEVEARKKAVVQLAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−NGQ−−−EGLLVASKIADKVGITRSVIVNALRKFESAGLIESRSLGMKGTHIKILNDRLLDELRKI
fig|457396.3.peg.1689   Clostridium sp. 7_2_43FAA     MSSLLNKTRMLNKILQKSGTD−−−−−−−−−PVAFEDICSLLSEVLLCNVYVASRKGKILGYSFSKSFE−−−CDVMKNQVIDE−−KRFPKDYNDNLLNVHESIANLANKG−−LCVFENQGNCIMEDKISTIVPIIGNRERLGTLILA−−RFGEEFTDEDLVLAEYSATIVGMEILRSKQLEIEDEARKKAVVQLAIGTLSYSELEAVEHIFGEL−−−−−−−−−−−−−−−EGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNEKLLDELKKI
fig|445334.5.peg.600   Clostridium perfringens C str. JGS1495     MSTLLSKTRRLNKILQKSGTE−−−−−−−−−AIAFGDICQLLSDVMSCNVYLVGRKGRILGYSFSEKFE−−−CDIMKEKVVVD−−RKFPEDYNNKLINIQDTIANIPNKG−−ICVFEGVGECLISKKISTIVPIVGNGDRLGTLLLA−−RFGEEFNDDDLVLAEYSATIVGMELLRARQGEIEEEARKKAVVQLAIGTLSYSELEAVEHIFSEL−−−−−−−−−−−−−−−NGD−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNEKLMDELKKI
fig|632245.3.peg.3078   Clostridium butyricum E4 str. BoNT E BL5262     MSSLLKKTRMLNKILQKSGKD−−−−−−−−−PVAFQDICRLLSDVLECNAYIISQKGKVLGYAFGHDFE−−−CEAMKKKVIED−−KKFPEDYNKTLLNTNETIANVPNEG−−RCVFEEIGKCKKVDKLSTIVPIMGSRERLGTLILA−−RFGTSFTDDDLVLVEYSATIVGMEMLRAMQDEIAEETRKKAVVQLAIGTLSYSELEAVEHIFDEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTYIRILNEKLVEELRKI
fig|290402.34.peg.1179   Clostridium beijerincki beijerinckii NCIMB 8052     MSSLLTKTRMLNKILQKSGTE−−−−−−−−−PVAFQDICTLLSEVLECNVYIISKKGKVLGYTFGKDFE−−−CEAMKKKVIED−−KKFPEDYNKTLLEVNETLSNLPNEG−−RCVFQEIGKCKKVDKLSTIVPIIGSRERLGTLILA−−RFGNPFTDEDLVIVEYSATIVGMEMLRAMQDEITEDTRKKAVVQLAIGTLSYSELEAVEHIFDEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTYIRILNEKLIDELKKI
fig|1221327.3.peg.1456   Clostridium botulinum CDC66177     MSSLLSKTRRLNKILQKTGTE−−−−−−−−−PVAFQDICTLLSEVLECNAYIVSKRGKVLGYTFSPGFE−−−CEAMKKKVIED−−KKFPEDYNLTLLESNETLANLYNQG−−RCVFAEIGDCKTKDKISTIIPIIGSRERLGTLILA−−RFGKEFTDDDLVLVEYSATIVGMEMLRALQEDLADQTRKKAVVQLAIGTLSYSELEAVEHIFEEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTYIRVLNEKLLDELKKI
fig|508767.4.peg.1137   Clostridium botulinum E3 str. Alaska E43     MSSLLSKTRRLNKILQKTGTE−−−−−−−−−PVAFQDICTLLSEVLECNAYIVSKRGKVLGYTFSPGFE−−−CEAMKKKVIED−−KKFPEDYNLTLLESNETLANLSNQG−−RCVFAEIGDCKTKDKISTIIPIIGSRERLGTLILA−−RFGKEFTDDDLVLVEYSATIVGMEMLRALQEDLADQTRKKAVVQLAIGTLSYSELEAVEHIFEEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTYIRVLNEKLLDELKKI
fig|293826.4.peg.2638   Alkaliphilus metalliredigens QYMF      SELLEKTRRINRILQQSGDH−−−−−−−−−AVSFNELCRILSEVLDANVYVASARGKVLGVSLTDATD−−−CPIVVDERTGE−−KRFPEEYNEQLLKVTETEFNITQDEL−−LKFFKYDIESY−−−DKLVTIVPISGSGNRLGTIVLA−−RFEKEFTDEDLVMVEYSSTVVGLEILRAKTELIEEEARKKAVVQMAVGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−DGM−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDHLLEELRRL
fig|350688.5.peg.1544   Alkaliphilus oremlandii OhILAs       TLLGKTRKINKILQQSADS−−−−−−−−−NISFNEVCKILSEILDANAYVASSKGKVLGVSLTDTSD−−−CPIVTDEKTGE−−KRFPEEYNEQLLHVSETRANITKDEL−−LSIFKYDIDSY−−−EKLVTIVPINGSGQRLGTLVLA−−RFEREFNDDDLVMAEYSSTVVGMEIMRSESEAIEAEARKKAVVQMAIGTLSYSELEAVEHIFSEL−−−−−−−−−−−−−−−EGE−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDHLLDELKKL
fig|546269.3.peg.831   Filifactor alocis ATCC 35896     SSVLLQKTRTINKFLQNSGNK−−−−−−−−−PVSFSVLSDTLNEVLSSNVYILSSKGKVLGSSFTHEAD−−−SSIVLDENSGE−−EKLPQDYIDNVNKASETIANLTKESL−−LSVFKGDIGSY−−−NKYATIVPIVGGGDRLGTLILS−−RYDKEFSDDDLILAEYSATVVGMEILRSKSEEIEEEMRNKAVVQMAIGTLSYSELEAVIHIFNEL−−−−−−−−−−−−−−−NGS−−−EGLLVASKVADRAGITRSVIVNALRKFESAGVIESRSLGMKGTHIKVLNDKLLDELKKH
fig|596329.3.peg.1310   Peptostreptococcus anaerobius 653-L      SSLLENTRRINKTLQSTAGT−−−−−−−−−SVSFDQLSSALGNVLNSNVYVVRNRGKVLGYYLITPED−−−SSVQVDEENT−−NMFPKEYAENVLMVYETKENMSKEEI−−LKIFPFEHDRL−−−NKYTTLVPIMGSGERLGTLVLS−−RYDEPFTDDDLVMAEYSATVIGMEILRAISEEMEENMRKKAVVQMAIGTLSYSELEAIEHIFEEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADKVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLLEELKNH
fig|500633.7.peg.951   Clostridium hiranonis DSM 13275      SELLQKTRKINKTLQTSGGS−−−−−−−−−NISFNLLAGVLGDVLESNTYIISAKGKVLGLHLTDEAD−−−SSVIEDEITKQ−−KWFPEEYTKNLLKIEDTKENITGEEM−−LKIFPYEHGRL−−−NKKTIVVPIHGSGERLGTLIIT−−RYEKDFNDEDLVVAEYSATVVGLEILRAISEEMEEEMRKKAVVQMAIGTLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLLEELAK 
fig|445973.7.peg.2068   Clostridium bartlettii DSM 16795      SEVLQKTRRINKTLQTSSGS−−−−−−−−−KVSFDKLAETLGEVLDANVYVLNTKGKVLGLYLTDIQD−−−SSVIIDEDTKQ−−KRFSIEYNESLLKISETLENLTGDEL−−VRLFPEEHVRS−−−EKYLTTVPILGSGQRLGSLVLA−−RYKKAFNDDDLVISEYSATVIGMEILKSLSEEMEVEMRKKAVVQMAIGTLSYSELEAVEHIFNEL−−−−−−−−−−−−−−−NGN−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKILNDKLIPELKK 
fig|699034.5.peg.1204   Clostridium difficile BI1      SEVLQKTRKINKTLQTSGGS−−−−−−−−−SVSFDLLAGALGDVLSSNVYVVSAKGKVLGLHLNDVQD−−−SSVIEDEYTKQ−−KKFSDEYTQNVLKIDETLENLNGEKI−−LEIFPEEHGRL−−−QKYTTVVPILGSGQRLGTLVLS−−RYSNSFNDDDLVIAEYSATVVGLEILRAIGEELEEEMRKKAVVQMAIGTLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLTDELKKL
fig|499174.4.peg.557   Clostridium difficile QCD-23m63      SEVLQKTRKINKTLQTSGGS−−−−−−−−−SVSFDLLAGALGDVLSSNVYVVSAKGKVLGLHLNDAQD−−−SSVIEDEYTKQ−−KKFSDEYTQNVLKIDETLENLNGEKI−−LEIFPEEHGRL−−−QKYTTVVPILGSGQRLGTLVLS−−RYSNSFNDDDLVIAEYSATVVGLEILRAIGEELEEEMRKKAVVQMAIGTLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLTDEIKKI
fig|699036.5.peg.1240   Clostridium difficile CF5      SEVLQKTRKINKTLQTSGGS−−−−−−−−−SVSFDLLAGALGDVLSSNVYVVSAKGKVLGLHLNDAQD−−−SSVIEDEYTKQ−−KKFSDEYTQNVLKIDETLENLNGEKI−−LEIFPEEHGRL−−−QKYTTVVPILGSGQRLGTLVLS−−RYSNSFNDDDLVIAEYSATVVGLEILRAIGEELEEEMRKKAVVQMAIGTLSYSELEAVEHIFAEL−−−−−−−−−−−−−−−DGK−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIRILNDKLTDELKKL
fig|292459.1.peg.1425   Symbiobacterium thermophilum IAM 14863     MKTLLEKTRRINRLLQKSAGT−−−−−−−−−QVNFNELAGVLADLIGADVYVASRKGNIVGLGLTAGDA−−−−−−−−−DAYQN−−ITFTEEYNSSLMKVDDTTANTEQSE−−−LTVLQEGREVQMRGGRVTIVPVNGGGERLGTLVLV−−K−−SADLTDEDLILGELAATVAGVEILRAHAGELEEEARKKAAVQIALATLSYSELEAVQHIFDEL−−−−−−−−−−−−−−−DGN−−−EGLLVASKIADRVGITRSVIVNALRKFESAGVIESRSLGMKGTHIKVLNDRLIEELRKL
fig|580327.3.peg.21   Thermoanaerobacterium thermosaccharolyticum DSM 571     MELLLEKIRKVNKVLQKTGVQ−−−−−−−−−PVDFNELSEILKDVINCDVFIVSRRGKLLGRNLDEYS−−−GELDESIIKS−−MQLPEDYNDELLKIAETSANLTKESK−−ATLIKND−−−−−−−NLFETIVPVFGGGNRLG<