(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00005276

fig|393130.3.peg.2705   Listeria monocytogenes J0161     WGYIHLISWVAIVVLTVTALLIYS−−−KSTKSFTMLQMINRVFYILVILSGIMMVKYSIEQ−−−−−−−SWILAIFKILMGIIVIGIVEMLLSYRKQQK−−−−PTGMFLMIFVIVVVITISLGFYLSGG
fig|932920.3.peg.2403   Listeria monocytogenes serotype 1/2c str. SLCC2372     WGYIHLISWVAIVVLTITALLIYS−−−KSTKSFTMLQMINRVFYILVILSGIMMVKYSIEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFVIVVVITISLGFYLSGG
fig|265669.9.peg.2314   Listeria monocytogenes str. 4b F2365     WGYIHLISWVAIVVLTVTALLIYS−−−KSTKSFTMLQMINRVFYILVILSGIMMVKYSIEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFVIVVVITISLGFYLSGG
fig|1030009.3.peg.2353   Listeria monocytogenes M7     WGYIHLISWVAIVVLTVTALLIYS−−−KSVKSFTMLQMINRVFYILVILSGIMMVKYSIEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFVIVVVITISLGFYLSGG
fig|1293288.3.peg.2246   Listeria monocytogenes serotype 1/2a str. NCCP No. 15743     WGYIHLISWVAIVVLTVTALLIYS−−−KSAKSFTMLQMINRVFYILVILSGIMMVKYSIEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFVIVVVITISLGFYLSGG
fig|272626.1.peg.2350   Listeria innocua Clip11262     WGYVHLISWVAIVVLTVTALLIYS−−−KSVKGFTMLQMINRVFYILVILSGIMMVQYSVKE−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFIIVVVITVSLGFYLSGG
fig|386043.9.peg.2291   Listeria welshimeri serovar 6b str. SLCC5334     WGYVHLISWVAIVVLTVTALAIYS−−−KSTKGFTILQMINRIFYILVILSGVMMVQYSVEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKQQK−−−−PTGMFLMIFIIVVVITVSLGFYLSGG
fig|683837.3.peg.2241   Listeria seeligeri serovar 1/2b str. SLCC3954     WGYIHLISWVAIVLLTVLALVIYP−−−KSTKSFTMLQMINRVFYILVILSGIMMVQYSVEQ−−−−−−−SWILAIFKILMGIIVIGVVEMLLSYRKSQK−−−−PTGMFLMIFVIVIVITVSLGFYLSGG
fig|525367.9.peg.668   Listeria grayi DSM 20601     WAVIHLIAWVAIVILTISAFSIYP−−−KNNKVFTILQMINRVFYIIVIGSGIIMARYGLAH−−−−−−−HLLPVIFKILLGILVIGIIEMLLSYRKKDR−−−−PTTLFFSLFFVSVILTVALGFYLSGG
fig|585506.3.peg.631   Weissella paramesenteroides ATCC 33313                                          MIARLDYIVAIVTGIGLFHYAYQS−−−−−−−NPILTIVKVILAILLIGIVEMSFAKKKRQQ−−−−LNRNFAIVVIVLILLLGLFGMYLASG
fig|525310.3.peg.487   Lactobacillus brevis subsp. gravesensis ATCC 27305     WLWIHLVTWFVLTIVVVLGLI−−−−−−AKSHKVTVWAMTARVLYLIAIISGVILLLGTWQY−−−−−−−NPILSTIKVILALGLIAFIEIAFARKQENK−−−−FHAGLIWWALCFCIVVGIVGLILSQG
fig|525318.3.peg.340   Lactobacillus buchneri ATCC 11577     WLWIHLMTWVVLTIVVVLGLI−−−−−−AKSHKVTGWAMTARVLYLIAIISGVILLLGTWQY−−−−−−−NPVLSTIKVILALGLIAFIEIAFARKQENK−−−−FHASLIWWALFFCIVVGIVGLILSQG
fig|1078018.5.peg.555   Lactobacillus rhamnosus CASL     WLWLHLISWAVLAVAAGIALF−−−−−−SRTRQFVMWTMIARVCYLVSIISGVVLMRFSFNR−−−−−−−NPMLTVIKILIAIGLIGLLEMAFADKKQQH−−−−LSKIIIWSAIAAFVLVTVVGFALAQF
fig|568703.30.peg.171   Lactobacillus rhamnosus GG (Prj:40637)     WLWLHLISWAVLAVAAGIALF−−−−−−SRTRQFVMWTMIARVCYLVSIISGVVLMRFAFNR−−−−−−−NPMLTVIKILIAIGLIGLLEMAFADKKQQH−−−−LSKIIIWSAIAAFVLVTVVGFALAQF
fig|537973.8.peg.1287   Lactobacillus paracasei subsp. paracasei 8700:2     WLWMHLVSWAVLIIAAGIALF−−−−−−SKTRQFLLWTMITRVCYLFSIVSGIVLMRFAFAR−−−−−−−NPLLTVVKILIAIGLIGLIEIAFAGKKDHR−−−−LSKPIVWSTLAALVLVTVAGFALAQF
fig|1256218.3.peg.2386   Lactobacillus paracasei subsp. paracasei Lpp122     WLWMHLVSWAVLIIAAGIALF−−−−−−SKTRQFMLWTMITRVCYLVSIVSGIVLIRFAFAR−−−−−−−NPLLTVVKILIAIGLIGLIEIAFAGKKDHR−−−−LSKPIVWSTLAALVLVTVAGFALAQF
fig|999378.3.peg.142   Lactobacillus casei LC2W     WLWMHLVSWAVLIIAAGIALF−−−−−−SKTRQFMLWTMITRVCYLVSIVSGIVLMRFAFAR−−−−−−−NPLLTVVKILIAIGLIGLIEIAFAGKKDHR−−−−LSKPIVWSTLAALVLVTVAGFALAQF
fig|321967.8.peg.161   Lactobacillus casei ATCC 334     WLWMHLVSWAVLIIAAGIALF−−−−−−SKTRQFMLWTMITRVCYLVSIVSGIVLMRFAFAR−−−−−−−NPLLTVVKILIAIGLIGLIEIAFAGKKDHR−−−−LSKPIVWSTLAALVLVTVAGFALAQF
fig|585891.3.peg.993   Staphylococcus aureus subsp. aureus Mu50-omega     MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHKMFWITMALIIITMVLGVILPLG
fig|553596.3.peg.2220   Staphylococcus aureus A9781     MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHKMFWITMALIIITMVLGVILPLG
fig|450394.6.peg.2722   Staphylococcus aureus subsp. aureus USA300_TCH959     MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−KSHKMFWITMALIIITMVLGVILPLG
fig|93062.19.peg.949   Staphylococcus aureus subsp. aureus COL     MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|93061.5.peg.828   Staphylococcus aureus subsp. aureus NCTC 8325     MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|548474.3.peg.2594   Staphylococcus aureus subsp. aureus TCH130     MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMILGVILPLG
fig|273036.3.peg.937   Staphylococcus aureus RF122     MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLMLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|585145.3.peg.1408   Staphylococcus aureus subsp. aureus 65-1322     MLHLHFLSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|1137131.3.peg.2320   Staphylococcus aureus subsp. aureus 122051     MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|1155084.3.peg.786   Staphylococcus aureus subsp. aureus 71193     MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLTLISGFWILIQSFMNG−−−−GANHMLLTLKMLCGVAVVGLMEVSIAKRKRHE−−−−QSHTMFWITIALIIITMVLGVILPLG
fig|629742.3.peg.207   Staphylococcus hominis SK119     MLHMHIVSWVLTIVLYIIAFLHISKSQGPTPTFKSLHMGLRVFMLLTLFSGFWELIEEFMAASHGEGGNHMLLTLKMLCGLGVVALMEVSLAKRKKHA−−−−PSHGLFWATIILIIITMALGIILPWG
fig|279808.8.peg.1953   Staphylococcus haemolyticus JCSC1435     MLHMHIASWALTIILYVIAFLHISKSQGPTPMFKPLQMALRVFMLLTLFSGFWLLIQEFMAASHGGGGNHMLLTLKMLCGIAVVALMEVSIAKRKKHE−−−−ASHGLFWATIILIIITMSLGIILPWG
fig|596319.3.peg.696   Staphylococcus warneri L37603     MLHVHILSWVLAIILFFATYLNISKVQGASPYFKPLQMLLRLFMVLALISGFWELIKEFAAASQGEGGNHMLLTLKMLCGLGVLALMEVSIAKRKKHE−−−−NSDKLFWMTIALIIVTIAIGIILPWG
fig|525378.3.peg.56   Staphylococcus epidermidis M23864:W1     MLHVHILSWVLAIILFIATYLNFSKVQGATPYFKPLHMALRLFMLLTLISGFWELIKEFVAAAHGGGGNHMLLTFKMLCGLAVIAFMEVSIAKRKKKE−−−−EGHKFFWITIALIVITMVIGIILPWG
fig|904334.4.peg.1773   Staphylococcus capitis VCU116     MLHVHILSWVLAIVLFIATYLNFSKIQGPSPYFKPLHMALRLFMLLTLFTGFWELIKEFIAAAHGDGGNHMLLTLKMLCGLAVIALMEVTIAKRKKKE−−−−EGHKFFWITIALIIITMAIGIILPWG
fig|1155133.3.peg.378   Staphylococcus epidermidis NIH05003     MLHVHILSWVLAIILFIATYLNYSQTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFMAASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQ−−−−TSHKFFWITIILIIITMAIGVILPWG
fig|1235440.3.peg.523   Staphylococcus epidermidis 12142587     MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFMAASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQ−−−−TSHKFFWITIILIIITMAIGVILPWG
fig|342451.11.peg.1801   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MLHMHIASWVLLIILFFAAYFNFSEKQGASPYFKPIHMLLRLFMLLVLISGFWVWIQSFSSGA−−−AGGHMLLTLKMICGVAVVALMEVTITKRKKGQ−−−−PSHGLMWTTIVVIILTMIIGIILPMG
fig|883164.3.peg.883   Staphylococcus lugdunensis ACS-027-V-Sch2     MLHVHILSWVLAIIMFIVTYLNYSKTQGGTPTAKPLHMVLRVVILLTLISGFWIIIKEFASG−−−−GGNHMLLTLKMVCGIAVVALMEVTIIKRKKHE−−−−STQGLFWTTIA                
fig|396513.4.peg.580   Staphylococcus carnosus subsp. carnosus TM300     MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFATAT−−−GSTHMLLTLKMICGIGVVALMEVTLVRKQRGA−−−−SHKGLFWGTIALIIVTMALGIILPGG
fig|262543.4.peg.736   Exiguobacterium sibiricum 255-15     FVHTHVLLWILLLVTFFVAFSMYK−−NGKSAAKGVHMAFRLLLLLTFGTGLYLYITIMGQS−−−ANPDGLYHAKITAGLLVLIFGELTLVRLKKGK−−−−SYSGFLLGFAVLVLVTIFLGYSLPYG
fig|262543.8.peg.747   Exiguobacterium sibiricum 255-15     FVHTHVLLWILLLVTFFVAFSMYK−−NGKSAAKGVHMAFRLLLLLTFGTGLYLYITIMGQS−−−ANPDGLYHAKITAGLLVLIFGELTLVRLKKGK−−−−SYSGFLLGFAVLVLVTIFLGYSLPYG
fig|360911.3.peg.2469   Exiguobacterium sp. AT1b     FLHTHVTSWILLLILFAVAYIGYK−−NGNKSGKIAHMAFRLMLLIAFGTGLYLYLQLNGG−−−−−−−−GTFYHVKITVGLLTLIFGEMTLVKVKKKK−−−−PSNGLFGGFIVLALITIFIGYALPYG
fig|1315975.3.peg.1142   Bacillus subtilis PS216     MTHLHITTWVVALILLFVSYSLYS−−SGSAKGAKITHMILRLFYILIILTGAELFVRFANW−−−−−−−−NGEYAGKMILGIITIGLMEMLLIRKKKEK−−−−STGGLWVGFVIVLLLTVLLGLHLPIG
fig|703612.3.peg.3058   Bacillus subtilis subsp. spizizenii ATCC 6633     MTHLHITTWVVALILLFVSYSLYS−−SRSAKGAKITHMILRLFYILIILTGAELFVRFANW−−−−−−−−NGEYAGKMILGIITIGLMEMLLIRKKKEK−−−−STGGLWIGFVVVLVLTVLLGLHLPIG
fig|326423.5.peg.1065   Bacillus amyloliquefaciens FZB42     MTHWHITSWVVALILVFVSYGLYG−−SGKAKGAKITHMILRLFYIIIILTGAELFVRFANW−−−−−−−−NGEYAGKMLLGIITIGLMEMLVIRKKKGK−−−−STGGLWIGFIIVLVLTVLLGLHLPIG
fig|1232672.3.peg.1633   Bacillus licheniformis CGMCC 3963     MTHMHITSWVIALILVFVAYGLYS−−SGNSKGAKITHMILRLFYIIVIITGAQLFLKFTAW−−−−−−−−NGEYIAKALLGLITIGFMEMLLIRRKNGK−−−−AATGIWIGFIVVLLLTVVLGLRLPLG
fig|536229.4.peg.821   Bacillus pumilus ATCC 7061      THLHITAWVLGIILFFVAFALAG−−−KNDKGAKIVHMIVRLLYLIIIATGVELYVRTGMKI−−−PGFGGEYIGKMIFGILVIGFMEMVLVRKKKGK−−−−SVTGVLIGFIVLAIVTILLGLRLPIG
fig|315750.5.peg.904   Bacillus pumilus SAFR-032                        FALAG−−−KNDKGAKIVHMIVRLLYLIIIATGVELYVRTGMKI−−−PGFGGEYIGKMILGILVIGFMEMTLVRKKKGK−−−−SVTGVLIGFIIFAIVTILLGLRLPIG
fig|315750.8.peg.1022   Bacillus pumilus SAFR-032      THLHITAWVLGIILFFVAFALAG−−−KNDKGAKIVHMIVRLLYLIIIATGVELYVRTGMKI−−−PGFGGEYIGKMILGILVIGFMEMTLVRKKKGK−−−−SVTGVLIGFIIFAIVTILLGLRLPIG
fig|221109.1.peg.1183   Oceanobacillus iheyensis HTE831     MTHMHITSWALGLILFIIALVMYK−−KGNQKPAKIIHMILRLMFILIIITGGILTWDYIQGYG−−−MPILGEALVKALAGLWLVAMMEMILTGKAKGK−−−−PTTAKWVQFSIALVLVIVLGFFRLPMG
fig|358681.3.peg.4517   Brevibacillus brevis NBRC 100599      IEAHVGSWEVAFVLLIVAYILYR−−VGKAKAGKIVHMLLRLMMVIILVSGAWMLFVGHAT−−−−−−−−DFYYYVKGIIAVIAFGLMEMSLGKAKRQE−−−−GSIGFFIGCIVVLVLVILLGYRVLM 
fig|66692.3.peg.2789   Bacillus clausii KSM-K16     FQASHEGSWAILAILFLVAYFLFR−−GGKSKAGTIIHMIARLFFVIMLVTGASMLIAYQF−−−−−−−−AYFFFIKGILAVLLIGFMEAALGKAKRNE−−−−NSLGMLFAVLVVLVVIVLMGY      
fig|272558.1.peg.2983   Bacillus halodurans C-125     FYESHRGSWAILIILFLVSYFLIK−−AGKGKAGKILHMIVRLFFVIMLITGAGMLVYWQF−−−−−−−−AFLFIVKGVLAIVLIYAMEMLLTRTSKGTIGQQARIYWIVFITCLVLVALIGY      
fig|526999.3.peg.584   Bacillus mycoides Rock3-17     FLQIHAGSWAILIILFIMSYMLKK−−−−−−−−QEFTLWAQRAFYVLMLTSGVGMVVIKGF−−−−−−−−PVISMIKGIFALILIMSMEILISRRRKGE−−−−THSLWWGVFSITLIVILLIGFHV   
fig|526968.3.peg.5336   Bacillus cereus R309803     FYQIHAGSWAILIILFIMSYMLNK−−−−−−−−QEFTLWGQRAFYVLMLGSGIGMVVIKNF−−−−−−−−PVISMIKAVFALILIMSLEILVARKRRGQ−−−−THTLWWGIFAITFIVILLIGFHI   
fig|451707.4.peg.2522   Bacillus cereus NVH0597-99     FYQIHAGSWAILIILFIMSYMLNK−−−−−−−−QEFTLWGQRAFYVLMLGSGIGMVVIKNF−−−−−−−−PVISMIKAVFALILIMSMEILVARKRRGQ−−−−THTLWWGVFAITFIVILLIGFHI   
fig|398511.4.peg.507   Bacillus pseudofirmus OF4      YQSHIGSWAILVILFFICYFLMK−−SGKAKGAKIVHMVLRLFYIIMLVTGIGMLINLGF−−−−−−−−PLMYVVKGALAFFLIYAMEMILVRTKKGTLGSQATMYWAILIITLVLVVLLGY      
fig|439292.4.peg.2775   Bacillus selenitireducens MLS10     FLHSHALFWLIAIVLFILTTVMIR−−NGKQKPAKIMQMSLRLVYLLVFGTGLTMIFLVPTT−−−−−−−−−−MAIVKGILAFVLIYVMEMISLRMSKGTLTKQMATRLWAAFVVLLVVVLYFGYFL   
fig|649639.5.peg.3103   Bacillus cellulosilyticus DSM 2522      LHSHALFWFVGIVVFFLTVIFIN−−NGKAKASKILQMVLRLMYVLLLVTGIWLIVLNGF−−−−−−−−YWSAVVKGLLAIWLIFVMEFISNRMAKGSLSGKGKAIFWIQFIVAFVLVLYFGY      
fig|545693.3.peg.639   Bacillus megaterium QM B1551      LHIHVTLWTLLIISFVVSLILHR−−AGKAKGQKILHMVARLLYLLVLVSGLHMLAAWYHF−−−−−−−−QGAALIKGIAGVLVLVGMEMVLVRTEKRK−−−−RTGVAWAVLVIALILVFYYGY      
fig|592022.4.peg.563   Bacillus megaterium DSM319      LHIHVTLWTLLIISFVVSLILHR−−AGKAKGQKILHMVARLLYLLVLVSGLHMLAAWYHF−−−−−−−−QGAALIKGIAGVLVLVGMEMVLVRTEKRK−−−−RTGVAWGVLVIALILVFYYGY      
fig|491915.6.peg.2264   Anoxybacillus flavithermus WK1     MTHAHITTWVVALILFVVAIALQA−−KGHEKTKMLHMLLRLFYILIIATGAWILHSMSSF−−−−−−−−PFLYIVKVIVGLWVIGTMEMILVRTAKGK−−−−NTNVLWLQFIVAFVVVLYLGFKLPFG
fig|471223.3.peg.747   Geobacillus sp. WCH70     MTHAHITSWLITVILFFIAVSLQR−−SGASKAKIVQMALRLFYIFTVITGGLLLHSIASI−−−−−−−−SILYIIKAIVGLWLIGAMEMVLSGMKKGK−−−−NTNVAWIQWIVAFVLVLFLGFMLPLG
fig|581103.3.peg.780   Geobacillus sp. Y4.1MC1     MTHAHITSWLITIVLFFVAVSLLR−−SGSSKAKIVQMVLRLFYILTIITGLLLLHSIASI−−−−−−−−SILYIVKTIAGLWLIGAMEMVLISMKKEK−−−−SAKAAWIQWIIAFALALFLGLSLPLG
fig|544556.5.peg.1553   Geobacillus sp. Y412MC61     MTHAHITSWLITIVLFFLAVSMER−−QGAGKAKIVQMVLRLFYILTIVTGLLLLHSIASI−−−−−−−−SALYWLKALAGLWVIGAMEMVLAAEKKGK−−−−SAAARWTQWVIALAVT           
fig|550542.5.peg.667   Geobacillus sp. Y412MC52      THAHITSWLITIVLFFLAVSMER−−QGAGKAKIVQMVLRLFYILTIVTGLLLLHSIASI−−−−−−−−SALYWLKALAGLWVIGAMEMVLAAEKKGK−−−−SAAARWTQWVIALAVT           
fig|691437.3.peg.3111   Geobacillus sp. C56-T3      THAHITSWLITIVLFFLAVSMER−−QGAGKAKIVQMVLRLFYILTIVTGGLLLHSIASI−−−−−−−−SALYWLKALAGLWVIGAMEMVLAAVKKGK−−−−SAAARWTQWVIALVVT           
fig|495036.3.peg.598   Geobacillus sp. G11MC16                MIILFLIAVSMQR−−SGAAKANIIKMVLRLFYIITIITGLLLLHSIASI−−−−−−−−SGLYWLKALAGLWVIGAMEMVLVAGKKGK−−−−SMAAGWTQWVIALVVT           
fig|420246.5.peg.578   Geobacillus thermodenitrificans NG80-2     MTHAHITSWFIMIILFLIAVSMQR−−SGAAKANIIKMVLRLFYIITIITGLLLLHSIASI−−−−−−−−SGLYWLKALAGLWVIGAMEMVLVAGKKGK−−−−SMAAGWTQWVIALVVT           
fig|420246.7.peg.634   Geobacillus thermodenitrificans NG80-2      THAHITSWFIMIILFLIAVSMQR−−SGAAKANIIKMVLRLFYIITIITGLLLLHSIASI−−−−−−−−SGLYWLKALAGLWVIGAMEMVLVAGKKGK−−−−SMAAGWTQWVIALVVT           
fig|313627.6.peg.2109   Bacillus sp. NRRL B-14911     MTHAHIFTWVVALVLFFAALGMHN−−SGKAKGVKVVQMILRLFYLLIIGTGIWMLTSGINI−−−−−−−−DLLYVLKALLGLWVIAMIEMIIIRTTKGK−−−−KTSILWVQFVVAAILVIYLGLRLPLG
fig|441769.6.peg.1083   Bacillus coahuilensis m4-4      THLHITTWVVGIILFIVAYAMYK−−QGNEKAAKITHMSLRLFYILIIISGLLLFINYAAI−−−−−−−NHMLYGIKALVGIWVIGVFEMILVRTKKGK−−−−SLKVFWVQFVIALLAVLYLGFSLDIG
fig|444177.5.peg.1320   Lysinibacillus sphaericus C3-41      THLHITTWVVAIVIFLIAALM−−−−−−−GKQSKGLHMTLRLFYVLIIITGGALFIEGMNY−−−−−−NMGMLYGFKFIGGILVIGMMEMVLVRQKKNK−−−−PTGMFWILFAVFLLITLFLGFKLPMG
fig|1245026.4.peg.153   Bacillus coagulans XZL9      TDAHVTTWVIAILLFILALFLHR−−AGKEKAFKTVQMVLRLFYILVIVTGALLFFHNQRL−−−−−−−DPALYGLKLLGGILVIGMMEMITLRLSKRK−−−−STGILWVLLIIFFAAVLYLGLRLPMG
fig|161544.4.peg.2607   Bacillus sp. SG-1      THAHITTWVIGIILFFAALYLHK−−SGKKKAMKIVHMTLRLFYLLIILTGALLFWKHQGV−−−−−−−FPMQYGLKLLAGLWVIAMFEMILVRTKKGK−−−−GTVAFWAQLIIALLVTLYLGVWLPLG
fig|315749.4.peg.893   Bacillus cereus subsp. cytotoxis NVH 391-98      THLHITAWILGLLLFFVAYSMYT−−AGRK−−GKGVHMGLRLMYMIIIVTGFLLYQSIMKTAT−−−GNMHMWYGIKMLVGIWVIAAMEMILVKTSKQK−−−−QAGAFWVQFIIAFVVVLYIGLRLPMG
fig|315749.8.peg.922   Bacillus cytotoxicus NVH 391-98      THLHITAWILGLLLFFVAYSMYT−−AGRK−−GKGVHMGLRLMYMIIIVTGFLLYQSIMKTAT−−−GNMHMWYGIKMLVGIWVIAAMEMILVKTSKQK−−−−QAGAFWVQFIIAFVVVLYIGLRLPMG
fig|526999.3.peg.2006   Bacillus mycoides Rock3-17      THMHITAWALGIILFFVAYSMYT−−AGRK−−GKGVHMGLRLVYIIIIVTGFLLYQSIMKTAT−−−GNMHMWYGLKMLVGVWVIAAMEMVLVKTSKKK−−−−PAGAFWVQFIIALVIVLYLGLRLPMG
fig|527000.3.peg.1288   Bacillus pseudomycoides DSM 12442      THMHITAWALGLILFFVAYSMYT−−AGRK−−GKGVHMGLRLVYIIIIVTGFLLYQSIMKTAT−−−GNMHMWYGLKMLVGVWVIAAMEMILVKTSKKK−−−−PAGAFWVQFIIALVIVLYLGLRLPMG
fig|1053180.3.peg.4689   Bacillus cereus BAG2X1-2     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMGIMKTAT−−−SNMHMWYGLKMVAGILVIGGMEMVLVKMSKNK−−−−ATGAVWGLFIVALVAVFYLGLKLPIG
fig|412694.7.peg.1183   Bacillus thuringiensis str. Al Hakam     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMGIMKTAT−−−SNMHMWYGLKMIAGILVIGGMEMVLVKMSKNK−−−−ATGAVWGLFIVALVAVFYLGLKLPIG
fig|451707.4.peg.127   Bacillus cereus NVH0597-99     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMGIMKTAT−−−SNMHMWYGLKMIAGILVIGGMEMVLVKMSKNK−−−−ATGAVWGLFIVALVAVFYLGLKLPIG
fig|526986.3.peg.4312   Bacillus cereus Rock3-44     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYQGIMKTAT−−−GNMHMWYGLKMLAGILVIGGMEMVLVKMSKNK−−−−KTGAVWGLFIIALVAVFYLGLKLPIG
fig|1163722.3.peg.3592   Bacillus cereus LCT-BC244     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMGIMKTAT−−−SNMHMWYGLKMLAGILVIAGMEMVLVKMSKNK−−−−ATGAFWGLFIIALVAVFYLGLKLPIG
fig|334406.4.peg.1097   Bacillus cereus NC7401     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGVWLYLDQTIVD−−−KSYHMWYGLKMLAGILVIAGMEMVLVKMSKNK−−−−ATGAFWGLFIIALVAVFYLGLKLPIG
fig|526993.3.peg.5017   Bacillus cereus AH1272     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGMKMLAGILVIAGMEMVLVKMSKNK−−−−ATGAFWGLFIVALVAVFYLGLKLPIG
fig|226900.1.peg.1048   Bacillus cereus ATCC 14579     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGLKMLAGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVFYLGLKLPIG
fig|1257079.3.peg.1260   Bacillus thuringiensis DAR 81934     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGLKMLTGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVFYLGLKLPIG
fig|1257079.3.peg.6905   Bacillus thuringiensis DAR 81934     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGLKMLTGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVFYLGLKLPIG
fig|526968.3.peg.1240   Bacillus cereus R309803     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYILIIVTGFMLYMSIVKTAT−−−GSMHMWYGMKMLAGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVIYLGLKLPIG
fig|222523.1.peg.1250   Bacillus cereus ATCC 10987     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIFIIVTGFMLYMSIVKTAT−−−GSMHMWYGLKMLAGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVIYLGLKLPIG
fig|526992.3.peg.4462   Bacillus cereus AH1271     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGMKMLAGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVIYLGLKLPLG
fig|1053236.3.peg.1805   Bacillus cereus VD146     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGMKMLAGILVIAGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVLYLGLKLPLG
fig|527023.3.peg.3277   Bacillus thuringiensis serovar kurstaki str. T03a001     MVHMHITAWALGLILFFVAYSLYS−−AGRK−−GKGVHMGLRLMYIIIIVTGFMLYMSIVKTAT−−−GSMHMWYGLKMLAGILVIGGMEMVLVKMSKNK−−−−PTGAVWGLFIVALVAVLYLGLKLPLG