(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020382

fig|904330.3.peg.2068   Staphylococcus epidermidis VCU109     MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL
fig|525376.3.peg.215   Staphylococcus epidermidis W23144     MSLHFQILLWLSILFIIAGTILLVTMLKTKREERKESYLGFTVIFLIFGFAILIYTFIFGIL
fig|904334.4.peg.103   Staphylococcus capitis VCU116     MSLHFQILLWLAIIFIVAGAIILTIMLKTKKEERKESYLGFTVIFLIFGFAMLIYTLIFGL 
fig|525378.3.peg.1257   Staphylococcus epidermidis M23864:W1     MNLHFQILLWLSIIFIVAGAIILAIMLKTKKEERKESYLGFTVIFLIFGFAMLIYTFIFGIL
fig|279808.8.peg.2033   Staphylococcus haemolyticus JCSC1435     MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL
fig|629742.3.peg.135   Staphylococcus hominis SK119     MSTHLTILLWLGIIFVVAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYILLFGIL
fig|698737.3.peg.1965   Staphylococcus lugdunensis HKU09-01     MSTHLTILLWLGIIFVVAASLILFKLLRTKAGSKKESYLGFTVVFYIFGIALLIYVLIFGVL
fig|93061.5.peg.744   Staphylococcus aureus subsp. aureus NCTC 8325     MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL
fig|426430.8.peg.827   Staphylococcus aureus subsp. aureus str. Newman     MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTIILYIFGFAILIYTFIFGVL
fig|1158477.3.peg.276   Staphylococcus aureus M1216     MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL
fig|1158485.3.peg.2358   Staphylococcus aureus M1311     MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL
fig|585153.3.peg.1366   Staphylococcus aureus subsp. aureus E1410     MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVIHYIFGFAILIYTFIFGVL
fig|585155.3.peg.2159   Staphylococcus aureus subsp. aureus H19     MSLHFAILFWLALIFLVAATFILLLMKKTGTESKKESYLSFTVILYIFGFAILIYTFIFGVL
fig|585152.3.peg.732   Staphylococcus aureus subsp. aureus D139                SINFLSCRYVYTLINEKTGTESKKESYLSFTVILYIFGFAILIYTFIFGVL