(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020517

fig|455227.3.peg.2370   Staphylococcus aureus D30     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNFLMFMDTGSYIFMYFVIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIATIILS  
fig|450394.6.peg.2037   Staphylococcus aureus subsp. aureus USA300_TCH959     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTIWIIIATIILS  
fig|548474.3.peg.1679   Staphylococcus aureus subsp. aureus TCH130     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTIWIIIATIILS  
fig|1158477.3.peg.2377   Staphylococcus aureus M1216     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIATIILS  
fig|93061.5.peg.234   Staphylococcus aureus subsp. aureus NCTC 8325     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIATIILS  
fig|1158485.3.peg.230   Staphylococcus aureus M1311     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDNDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIVTIILS  
fig|931454.3.peg.786   Staphylococcus aureus subsp. aureus CIG1524     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDNDLSNFLMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIVTIILS  
fig|273036.3.peg.468   Staphylococcus aureus RF122     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDNDLSNFLMFMDTGSYIFMYFAIKCLRVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPL                
fig|273036.6.peg.248   Staphylococcus aureus RF122     MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDNDLSNFLMFMDTGSYIFMYFAIKCLRVKPKVVNYLIAKELGESK−−−−−−−−−EVIEEQELDLQTSKIRGIYFFIISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVPL                
fig|585152.3.peg.207   Staphylococcus aureus subsp. aureus D139     MIIFILLTVFALFYIAMIASLFKSEGFSIIGLILDIVILTTLIFYYFVGASFVDNDLSNFLAFMNFGSFVYMYYAIKSLWMKPKLVNYIIAKEIGESK−−−−−−−−−DVIEEQELDLQTSKIRGIYFFIIAIALLIITKIRMQPELQADAISMNPVFIFIGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIATIVLS  
fig|585151.3.peg.2175   Staphylococcus aureus subsp. aureus C427     MIIFILLTVFALFYIAMIASLFKSEGFSIIGLILDIVILTTLIFYYFVGASFVDNDLSNFLAFMNFGSFVYMYYAIKSLWVKPKLVNYIIAKEIGGSK−−−−−−−−−DVIEEQELDLQTSKIRGIYFFIIAIALLIITKLRMQPELQADAISMNPVFIFIGVIIILIWLVLDIYRKKKYGKFLFKTIVPLVVTTWIIIATIVLS  
fig|585145.3.peg.265   Staphylococcus aureus subsp. aureus 65-1322     MIIFILLTVFALFYIAMIASLFKSEGFSIIGLILDIVILTTLIFYYFVGASFVDNDLSNFLAFMNFGSFVYMYYAIKSLWVKPKLVNYIIAKEIGESK−−−−−−−−−DVIEEQELDLQTSKIRGIYFFIIAIALLIITKLRMQPELQADAISMNPVFIFIGVIIILIWLVLDIYRKKKYGIFLFKTIVPLVVTTWIIIATIVLS  
fig|525378.3.peg.1298   Staphylococcus epidermidis M23864:W1     MVFVVLIGLFILFYTIIFVSLLKTEGFAILPLCIDLLILISIIVFYYIGGYLKPKDLSNYLMFTMYGSYVYMYFAIKYFWIKPKVVEYVILKEHLNSD−−−−−−−−−EDLEERELNLQTARVRSVYYFIISVMLFIITKLRMNIDLKDDAVSVNSTLMLIGIIIIVLWLIIDFYRKGRYGIFLFKTIVP                 
fig|979204.3.peg.1116   Staphylococcus epidermidis NIHLM061     MVYFVLIGVFIIFYLALFDSLLKSENLSILSIILDFVIIVMLIVFHFIGNKLTGNDLSNYIAFTLIGSFVYMYFAIKNFWTKPKVLNYLISKQENANQ−−−−−−−−−DDIEYQELDLQVSKIKSVYYFLIAIALLILTKIHIVSDIKADSLSMNPVFIFVGMIIIVIWLIMDLYRKKKYGIFLFKSLIPIVVTVWIIISSVLL   
fig|596319.3.peg.1320   Staphylococcus warneri L37603     MDIILVIIVFGLFYLVHFTSVMHSGGLKVLPIMTYILSLILYLIPVILIKEESANQFENLMLILNIGVLLYGIMGVRCLWSRPLKVKI−−−QELTKSSDKMITQHKYDKIESMKINLEIAKYKGIISLLISFIFMITMSIKASSQYKEDFAFGNIIIIYIFIVIFVIYIIIDIIFRMTKGRWRLISIRPLVMSIWLFIFIVILLIQ
fig|1158477.3.peg.2392   Staphylococcus aureus M1216     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAILFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAFVVIRPILFSCWIFILNMILSRL
fig|1158486.3.peg.2506   Staphylococcus aureus M1320     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAILFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAFVVIRPILFSCWIFILNMILSRL
fig|553581.3.peg.2224   Staphylococcus aureus A9299     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAILFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRD                                                      
fig|455227.3.peg.2612   Staphylococcus aureus D30     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAFVVIRPILFSCWLFILNMILSRL
fig|93061.5.peg.249   Staphylococcus aureus subsp. aureus NCTC 8325     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAFVVIRPILFSCWLFILNMILSRL
fig|450394.6.peg.2051   Staphylococcus aureus subsp. aureus USA300_TCH959     MEFLLLIVVAGLYYMIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAFRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIVIFAVWDLIIRVRKGAFTFVVIRPTLFSCWLFILNMILSRL
fig|548474.3.peg.2591   Staphylococcus aureus subsp. aureus TCH130     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAFRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIVIFAVWDLIIRVRKGAFTFVVIRPTLFSCWLFILNMILSRL
fig|273036.3.peg.480   Staphylococcus aureus RF122     VSLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFIGD−−SYDQLTNFNVILYMGSLFYAWMAFRNIWNRPLLLKY−−−KNITDSSSGIVNKSEYNAVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMILSRL
fig|273036.6.peg.267   Staphylococcus aureus RF122                                                                       MGSLFYAWMAFRNIWNRPLLLKY−−−KNITDSSSGIVNKSEYNAVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMILSRL
fig|762962.3.peg.1527   Staphylococcus aureus subsp. aureus ATCC 51811     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVVIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAFRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRGLSISFFILSLFIIIIFAVWDLIIRVRKGAFAFVVIRPILFSCWLFILNMILSRL
fig|282459.1.peg.263   Staphylococcus aureus subsp. aureus MSSA476     MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVVIGITYIFIGD−−SYDQLTNFNVILYMGSLFYAWMAFRNLWNRPLLLKY−−−KNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLIIRVRKGAFAFVVIRPILFSCWLFILNMILSRL