(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010380

fig|290318.4.peg.187   Prosthecochloris vibrioformis DSM 265                      RKNIIRRD−−−A−−FQC−−−Q−−YCG−−−−KT−−DAP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPRSRGG−−−−EDSWE−−−−−−−−−−−−N−−−−LITACRRCNSK  
fig|290318.6.peg.211   Chlorobium phaeovibrioides DSM 265                      RKNIIRRD−−−A−−FQC−−−Q−−YCG−−−−KT−−DAP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPRSRGG−−−−EDSWE−−−−−−−−−−−−N−−−−LITACRRCNSK  
fig|319225.3.peg.269   Pelodictyon luteolum DSM 273                      RKNIIRRD−−−R−−FQC−−−Q−−YCG−−−−RT−−DQQ−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−TPRSRGG−−−−EDSWE−−−−−−−−−−−−N−−−−LITACRKCNAK  
fig|290512.6.peg.176   Prosthecochloris aestuarii DSM 271        TFFVRVPYKKLMLSRKNIFRRD−−−N−−FQC−−−Q−−YCG−−−−RK−−ERL−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−LPRSKGG−−−−EESWE−−−−−−−−−−−−N−−−−LITACSSCNTK  
fig|290317.7.peg.2613   Chlorobium phaeobacteroides DSM 266        TFFVRVPFKKIMLNRKNILRRD−−−N−−FQC−−−Q−−YCG−−−−RT−−DQP−−−−−−−−−−−−−MT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPRSKGG−−−−EDSWE−−−−−−−−−−−−N−−−−LITACPACNTK  
fig|377431.3.peg.2117   Chlorobium ferrooxidans DSM 13031                      RKNILLRD−−−A−−YQC−−−Q−−YCG−−−−RT−−DLP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−VPRSRGG−−−−DYSWE−−−−−−−−−−−−N−−−−LITACRRCNTK  
fig|517418.5.peg.1756   Chloroherpeton thalassium ATCC 35110         FYVAVPFKRIMLNRKNILRRD−−−N−−FEC−−−Q−−YCG−−−−RT−−DLP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPKSQGG−−−−GDTWN−−−−−−−−−−−−N−−−−LVTACTKCNNK  
fig|517418.3.peg.1753   Chloroherpeton thalassium ATCC 35110         FYVAVPFKRIMLNRKNILRRD−−−N−−FEC−−−Q−−YCG−−−−RT−−DLP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPKSQGG−−−−GDTWN−−−−−−−−−−−−N−−−−LVTACTKCNNK  
fig|290315.5.peg.184   Chlorobium limicola DSM 245                      KKNILRRD−−−A−−FRC−−−Q−−YCG−−−−RT−−DLP−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LPRSRGG−−−−EESWE−−−−−−−−−−−−N−−−−LITACLRCNTK  
fig|517417.4.peg.685   Chlorobaculum parvum NCIB 8327                      RKNIFRRD−−−G−−YRC−−−Q−−YCG−−−−RN−−DLQ−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−IPKSRGG−−−−EDRWD−−−−−−−−−−−−N−−−−LITACKPC     
fig|194439.1.peg.715   Chlorobium tepidum TLS                      RKNLFRRD−−−G−−FRC−−−Q−−YCG−−−−CK−−DGS−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−MPKSRGG−−−−EDTWE−−−−−−−−−−−−N−−−−LITACKSCNTK  
fig|518766.5.peg.2413   Rhodothermus marinus DSM 4252        KWYVRVPYKHIMLNRRNILRRD−−−G−−YRC−−−Q−−YCG−−−−SR−−EN−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−IPRSRGG−−−−RDTWE−−−−−−−−−−−−N−−−−LVTACTRCNNR  
fig|309807.19.peg.1230   Salinibacter ruber DSM 13855          YANVPYKRVMLSRKNVLKRD−−−R−−NTC−−−Q−−YCG−−−−AQ−−SN−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−VPKSRGG−−−−RDTWE−−−−−−−−−−−−N−−−−LVAACVTCNNQ  
fig|504728.6.peg.2831   Meiothermus ruber DSM 1279                      RRNILRRD−−−G−−YTC−−−Q−−YCG−−−−KR−−GGD−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−FPKSRGG−−−−RSIWE−−−−−−−−−−−−N−−−−LVTACRPC     
fig|526227.6.peg.1451   Meiothermus silvanus DSM 9946                      RRNVLRRD−−−A−−YTC−−−Q−−YCG−−−−RR−−GGD−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−LPKSRGG−−−−RSSWE−−−−−−−−−−−−N−−−−LVTACRPC     
fig|498848.5.peg.195   Thermus aquaticus Y51MC23                      RRNVLRRD−−−R−−YTC−−−Q−−YCG−−−−RQ−−GGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−LPKSRGG−−−−RSTWE−−−−−−−−−−−−N−−−−LVAACRAC     
fig|798128.4.peg.371   Thermus thermophilus JL-18                      RRNVLRRD−−−R−−YTC−−−Q−−YCG−−−−QK−−GGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−LPKSRGG−−−−KSTWD−−−−−−−−−−−−N−−−−LVAACRSC     
fig|234267.13.peg.3577   Solibacter usitatus Ellin6076                      RKNILMRD−−−R−−YTC−−−Q−−YCH−−−−RSLASGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−IPRSRAG−−−−ESAWE−−−−−−−−−−−−N−−−−LVACCHYCNNR  
fig|321327.20.peg.2762   Synechococcus sp. JA-3-3Ab           KERAWRVPPVNRREVLRRD−−−H−−HTC−−−Q−−YCG−−−−ST−−−HN−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−VPLSRGG−−−−SHTWD−−−−−−−−−−−−N−−−−VVTACERCNQR  
fig|321332.11.peg.965   Synechococcus sp. JA-2-3B'a(2-13)           KERAWRVPPVNRREVLRRD−−−H−−HTC−−−Q−−YCG−−−−TT−−−HN−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−VPLSKGG−−−−SHSWD−−−−−−−−−−−−N−−−−VVTACERCNQR  
fig|316274.7.peg.4347   Herpetosiphon aurantiacus ATCC 23779                      RREIFRRD−−−H−−YTC−−−Q−−YCN−−−−RS−−SAD−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−LPRHRGG−−−−AHSWE−−−−−−−−−−−−N−−−−LVSACRTCNHRK 
fig|316274.3.peg.4315   Herpetosiphon aurantiacus ATCC 23779                      RREIFRRD−−−H−−YTC−−−Q−−YCN−−−−RS−−SAD−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−LPRHRGG−−−−AHSWE−−−−−−−−−−−−N−−−−LVSACRTCNHRK 
fig|309799.3.peg.734   Dictyoglomus thermophilum H-6-12                      RKGIFLRD−−−N−−YTC−−−Q−−YCG−−−−KK−−GGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−IPKRLGG−−−−KSVWE−−−−−−−−−−−−N−−−−LVTACKECNHKK 
fig|309799.4.peg.729   Dictyoglomus thermophilum H-6-12                      RKGIFLRD−−−N−−YTC−−−Q−−YCG−−−−KK−−GGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−IPKRLGG−−−−KSVWE−−−−−−−−−−−−N−−−−LVTACKECNHKK 
fig|515635.4.peg.929   Dictyoglomus turgidum DSM 6724                      RKGIFLRD−−−N−−YTC−−−Q−−YCG−−−−KK−−GGE−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−IPKRLGG−−−−KSVWE−−−−−−−−−−−−N−−−−LVTACKECNHKK 
fig|70447.3.peg.453   Ostreococcus sp. RCC809                      RRNIFIRD−−−G−−FQC−−−Q−−YCG−−−−AK−−DN−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−VPASKGG−−−−PWTWE−−−−−−−−−−−−N−−−−LTTACSKCNNK  
fig|547146.3.peg.470   Hydrogenobaculum sp. SN             KTFYKNIPTRYNVYVRD−−−N−−FTC−−−G−−YCG−−−−KVCDDSE−−−−−−−−−−−−−IT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−VPVSKGG−−−−KWTWD−−−−−−−−−−−−N−−−−LVTACESCNAK  
fig|380749.5.peg.68   Hydrogenobaculum sp. Y04AAS1             KTFYKNIPTRYNVYVRD−−−N−−FTC−−−G−−YCG−−−−KVCDDSE−−−−−−−−−−−−−IT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−IPVSKGG−−−−KWTWD−−−−−−−−−−−−N−−−−LVTACESC     
fig|411490.6.peg.850   Anaerostipes caccae DSM 14662                   KKIRFEVFKRD−−−S−−FTC−−−Q−−YCG−−−−RSAPDVI−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−NPVANGG−−−−DNDIM−−−−−−−−−−−−N−−−−LITSCRDC     
fig|525378.3.peg.309   Staphylococcus epidermidis M23864:W1                    KTRFEVFKRD−−−N−−FTC−−−Q−−YCG−−−−KSAPEVV−−−−−−−−−−−−−LN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−EPVSKGG−−−−SNDIS−−−−−−−−−−−−N−−−−LITSCFECNN   
fig|138119.41.peg.3811   Desulfitobacterium hafniense Y51                   KKIRFEVYKRD−−−K−−FTC−−−Q−−YCG−−−−RKAPDVI−−−−−−−−−−−−−LN−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−EPISKNG−−−−SNDIL−−−−−−−−−−−−N−−−−LITSCFDCNN   
fig|479433.5.peg.3066   Catenulispora acidiphila DSM 44928                   KRLRYEILRRD−−−N−−HTC−−−R−−YCG−−−−ATAPTVP−−−−−−−−−−−−−LR−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−VPVALGG−−−−TDDAT−−−−−−−−−−−−N−−−−LVASCEPC     
fig|525368.3.peg.2076   Mycobacterium parascrofulaceum ATCC BAA-614                   KRLRFEILRRD−−−N−−HTC−−−R−−YCG−−−−VTAPDAK−−−−−−−−−−−−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−IPEALGG−−−−SDDPS−−−−−−−−−−−−N−−−−LVAACGDC     
fig|367336.3.peg.295   Rhodobacterales bacterium HTCC2255                   KRSRAEVLARD−−−N−−YKC−−−S−−DCG−−−−−−−−−−−−RTVDDG−−CKLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−IPASHGGQ−−−−−−−−−−−−−−NNLEN−−−−LITNCADC     
fig|394503.6.peg.3244   Clostridium cellulolyticum H10                        RILCRD−−−N−−FTC−−−K−−ECG−−−−−−LFAAYKNKHGLFVPIAVGLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−IQVSEGG−−−−−−−−−−−−−−−−TDQQNN−−−−LITICNDCHNQ  
fig|394503.7.peg.3248   Clostridium cellulolyticum H10                        RILCRD−−−N−−FTC−−−K−−ECG−−−−−−LFAAYKNKHGLFVPIAVGLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−IQVSEGG−−−−−−−−−−−−−−−−TDQQNN−−−−LITICNDCHNQ  
fig|349966.3.peg.301   Yersinia frederiksenii ATCC 33641                     VRVKVLERD−−−H−−HSC−−−R−−NCGWQ−−−−−−−−YQLKK−−PSDPRSLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−LHHI−−EHHV−−−−−−−−−−−DGGE−−−−−NTVEN−−−−LITLCNVCHDE  
fig|527012.3.peg.4127   Yersinia kristensenii ATCC 33638                     VRVKVLERD−−−H−−HSC−−−R−−NCGWQ−−−−−−−−YQLKK−−PNDPRSLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−LHHI−−EHHV−−−−−−−−−−−DGGE−−−−−NTVEN−−−−LLTLCNVCHDE  
fig|335543.6.peg.2884   Syntrophobacter fumaroxidans MPOB                     VRRQVLQRD−−−A−−HKC−−−L−−RCGWS−−−−−−−−HERWN−−PSDPRHLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHV−−DPHG−−−−−−−−−−−RGGE−−−−−NTPEN−−−−LITLCNICHD   
fig|324925.5.peg.686   Pelodictyon phaeoclathratiforme BU-1                     IRREVLQRD−−−D−−YRC−−−Q−−QCGWH−−−−−−−−QEMWN−−QSDPRHLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHI−−KQHV−−−−−−−−−−−EGGE−−−−−NTKEN−−−−LVTLCNICHDK  
fig|368407.6.peg.381   Methanoculleus marisnigri JR1          RDKYTLRRWKETRSGVLERD−−−G−−NRC−−−T−−VCGGE−−−−−−−−QD−−−−−−−−−−−−LH−−−−−−−−−−−−−−−−−−−−−−−−−−−−IHHI−−DR−−−−−−−−−−−−−DPTN−−−−−DVPSN−−−−LVTLCDICHAR  
fig|469382.4.peg.3392   Halogeometricum borinquense DSM 11551                    DTRDDVLEKY−−−K−−HRC−−−Q−−ACG−−−−−−−−−−−−RRGPGKGGLATLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ERDPDGMGE−−−−−−−−−−−−−−HDLEN−−−−LTLLCRSCH    
fig|491916.7.peg.3288   Rhizobium etli CIAT 652                  WEDTRRLVLARD−−−G−−FKC−−−V−−SCS−−−−TKVKSSD−−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−LPRSMGG−−−−SDELS−−−−−−−−−−−−N−−−−LVTLCDGCH    
fig|326442.4.peg.3205   Pseudoalteromonas haloplanktis TAC125                    NVKAYVLQRD−−−N−−YKC−−−Q−−SGR−−−−KTKHNAK−−−−−−−−−−−−−LH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−VFRSQGG−−−−TDALS−−−−−−−−−−−−N−−−−LIALCETCHN   
fig|1053234.3.peg.2806   Bacillus cereus VD136                  WNTRYYVFTRD−−−H−−YTC−−−Q−−ICK−−−−−−−−−−−−KKGG−−−−−−−ILH−−−−−−−−−−−−−−−−−−−−−−−−−−−−THHI−−−−−−−−−−−−−−−−I−−ERCSGGSDMADN−−−−LVTVHEECHQK  
fig|527000.3.peg.2221   Bacillus pseudomycoides DSM 12442                  WNTRYYVFTRD−−−H−−YTC−−−Q−−ICK−−−−−−−−−−−−KKGG−−−−−−−ILH−−−−−−−−−−−−−−−−−−−−−−−−−−−−THHI−−−−−−−−−−−−−−−−I−−ERCSGGSDMADN−−−−LVTVHEECHQK  
fig|485913.3.peg.1393   Ktedonobacter racemifer DSM 44963                   ENLRIACLMRD−−−G−−YAC−−−Q−−HCG−−−−KQK−−VR−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHL−−IFKGEGG−−−−KDTLT−−−−−−−−−−−−N−−−−LLTLCEACHKK  
fig|403833.5.peg.1114   Petrotoga mobilis SJ95                    NVREYVLWRD−−−N−−YTC−−−QR−−CK−−−−−−−−−−−−−−−−−DKSKDKRLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRQIG−−−−GNAPS−−−−−−−−−−−−N−−−−LITLCETCHK   
fig|403833.7.peg.1120   Petrotoga mobilis SJ95                    NVREYVLWRD−−−N−−YTC−−−QR−−CK−−−−−−−−−−−−−−−−−DKSKDKRLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRQIG−−−−GNAPS−−−−−−−−−−−−N−−−−LITLCETCHK   
fig|403833.5.peg.1210   Petrotoga mobilis SJ95                    NVREYVLWRD−−−N−−YTC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDKRLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRQIG−−−−GNAPS−−−−−−−−−−−−N−−−−LITLCETCH    
fig|403833.7.peg.1221   Petrotoga mobilis SJ95                    NVREYVLWRD−−−N−−YTC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDKRLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRQIG−−−−GNAPS−−−−−−−−−−−−N−−−−LITLCETCH    
fig|262543.8.peg.1411   Exiguobacterium sibiricum 255-15                   WNVREYVFFRD−−−K−−HMC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDKILN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRRTG−−−−GDAPD−−−−−−−−−−−−N−−−−LITLCETCHKK  
fig|439292.4.peg.429   Bacillus selenitireducens MLS10                   WNVREYVFFRD−−−N−−HRC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDKILN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRKTG−−−−GDSPD−−−−−−−−−−−−N−−−−LLTLCETCHKK  
fig|439292.4.peg.1425   Bacillus selenitireducens MLS10                   WNVREYVFFRD−−−N−−HRC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDKILN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRKTG−−−−GDSPD−−−−−−−−−−−−N−−−−LLTLCETCHKK  
fig|334413.6.peg.177   Finegoldia magna ATCC 29328                    NIREYVLFRD−−−N−−HTC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKDPILN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−ESRQTG−−−−GNSPN−−−−−−−−−−−−N−−−−LITLCESCHN   
fig|457570.14.peg.3029   Natranaerobius thermophilus JW/NM-WN-LF                   WNVREYVLYRD−−−N−−HTC−−−QY−−CR−−−−−−−−−−−−−−−−−GKSKDSILN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−RSRQSH−−−−GDRPG−−−−−−−−−−−−N−−−−LVTLCETCHTK  
fig|498214.7.peg.157   Clostridium botulinum A3 str. Loch Maree                    NLREYILHRD−−−G−−HKC−−−QNPNCK−−−−−−−−−−−−−−−−−SKGAESILQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−GFWKQDR−−−−SDRPG−−−−−−−−−−−−N−−−−LITLCNKCH    
fig|313606.3.peg.1362   Microscilla marina ATCC 23134                   WNIREYVLHRD−−−K−−HSC−−−QNPDCK−−−−−−−−−−−−−−−−−NKYKGKILQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−VFKSMGG−−−−GDTPN−−−−−−−−−−−−N−−−−LITLCTKCH    
fig|485913.3.peg.1658   Ktedonobacter racemifer DSM 44963                    NTRAFVLTRD−−−D−−YTC−−−QQ−−CT−−−−−−−−−−−−−−−−−GASKDQQLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−VFRSQNG−−−−SDEET−−−−−−−−−−−−N−−−−LVTLCKTCHD   
fig|485913.3.peg.1593   Ktedonobacter racemifer DSM 44963                    NTKAFVLTRD−−−D−−YTC−−−QQ−−CK−−−−−−−−−−−−−−−−−GKSKDQRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−VFRSQDG−−−−SDEPE−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.9249   Ktedonobacter racemifer DSM 44963                    NTKAFVLTRD−−−D−−YTC−−−QQ−−CK−−−−−−−−−−−−−−−−−GKSKDRRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQNG−−−−SNEPE−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.10920   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−E−−YTC−−−QH−−CR−−−−−−−−−−−−−−−−−GKSKDRRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQWG−−−−SDEEA−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.9538   Ktedonobacter racemifer DSM 44963                  FANTKAYVLTRD−−−G−−YLC−−−QQ−−CK−−−−−−−−−−−−−−−−−GKSKDRRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSRNG−−−−SDEEA−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.9017   Ktedonobacter racemifer DSM 44963                  FANTKAYVLTRD−−−G−−YLC−−−QQ−−CK−−−−−−−−−−−−−−−−−GKSKDRRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSRNG−−−−SDEEA−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.3650   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−G−−YLC−−−QH−−CK−−−−−−−−−−−−−−−−−GKSKETRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQNG−−−−SDEEA−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.1722   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−G−−YTC−−−QH−−CQ−−−−−−−−−−−−−−−−−GKSKDQRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQHG−−−−SDEES−−−−−−−−−−−−K−−−−LLTLCKTCHD   
fig|485913.3.peg.1235   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−G−−YTC−−−QH−−CQ−−−−−−−−−−−−−−−−−GKSKDQRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQHG−−−−SDEES−−−−−−−−−−−−K−−−−LLTLCKTCHD   
fig|485913.3.peg.1899   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−G−−YTC−−−QH−−CQ−−−−−−−−−−−−−−−−−GKSKDQRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQHG−−−−SDEES−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|485913.3.peg.8761   Ktedonobacter racemifer DSM 44963                    NTKAYVLTRD−−−G−−YTC−−−QH−−CQ−−−−−−−−−−−−−−−−−GKSKDQRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IFRSQHG−−−−SDEES−−−−−−−−−−−−N−−−−LLTLCKTCHD   
fig|675810.3.peg.3256   Vibrio sp. RC341                  WAKISSHYRVEKN−−−−−−FEC−−−E−−QCG−−−−−−−−−−−−−−VNMRSHRALLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−−−−−−−−−−−−−−−−−−−−−−−NGVKSDNRPSNLKALCIDCHSK  
fig|675815.3.peg.1528   Vibrio sp. RC586                  WAKISSHYRVEKN−−−−−−FEC−−−E−−QCG−−−−−−−−−−−−−−VNMRSHRALLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−−−−−−−−−−−−−−−−−−−−−−−NGVKSDNRPSNLKALCIDCHSK  
fig|410291.13.peg.1651   Vibrio harveyi HY01               SDDWSKISSHYRVEKN−−−−−−FEC−−−E−−ECK−−−−−−−−−−−−−−VNMRSNRALLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−−−−−−−−−−−−−−−−−−−−−−−NGVKSDNRPSNLRALCIDCHSK  
fig|675813.3.peg.166   Vibrio metschnikovii CIP 69.14               TADWPKISSHYRAEKN−−−−−−FDC−−−E−−ECK−−−−−−−−−−−−−−VNMRSNRALLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−−−−−−−−−−−−−−−−−−−−−−−NGVKSDNRVINLKSLCIDCHSK  
fig|575788.4.peg.2516   Vibrio splendidus LGP32               TDDWSRVSSRYRVDKN−−−−−−FKC−−−E−−DCK−−−−−−−−−−−−−−VNLRTNRSLLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−−−−−−−−−−−−−−−−−−−−−−−NGVKSDNNEENLRSLCIDCHSK  
fig|637616.3.peg.978   Methylophaga thiooxidans DMS010                  WDDISKKIKSEFN−−−−−−YIC−−−Q−−QCG−−−−−−−−−−−−−−LDLINNKRLLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−THHI−−−−−−−−−−−−−−−−−−−−−−−−NGVKHDNRKENLKPLCVDCHSK  
fig|439855.10.peg.4921   Escherichia coli SMS-3-5                  WKDISKSIREKAK−−−−−−YTC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|478007.5.peg.703   Escherichia coli O157:H7 str. EC508                  WKEISKEIREKAN−−−−−−YVC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|1005513.3.peg.4801   Escherichia coli PA48                  WKEISKEIREKAN−−−−−−YVC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|1005420.3.peg.4930   Escherichia coli 97.0007                  WKEISKEIREKAN−−−−−−YVC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|155864.1.peg.5222   Escherichia coli O157:H7 EDL933                  WKEISKEIREKAN−−−−−−YVC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|83334.1.peg.5235   Escherichia coli O157:H7                  WKEISKEIREKAN−−−−−−YVC−−−N−−DCG−−−−−−−−−−−−−−VNLSTAKNLCH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−−−−−−−−−−−−−−−−−−−−−−−NGIKYDNHHENLLVLCKDCHRK  
fig|43989.4.peg.2   Cyanothece sp. ATCC 51142               SKDWKTIADTIKSNA−−−G−−WGC−−−A−−KCGMQCIKPGEDVSKLTV−−KERKARTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHS−−DFTP−−−−−−−−−−−EN−−−−−−−NDPSN−−−−LIPLCTACH    
fig|32049.15.peg.170   Synechococcus sp. PCC 7002               SDDWQAIALQVKEDA−−−D−−WRC−−−E−−LCGLVCIPSDVKVKGIDR−−HLRAVLTLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−NYIP−−−−−−−−−−−ED−−−−−−−NRREN−−−−LIALCSACH    
fig|118168.3.peg.4405   Microcoleus chthonoplastes PCC 7420                  WSDIALSVKEAA−−−L−−WRC−−−R−−HCGKQCLRPGEKPSNLTR−−SEWTMATLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHA−−NFMP−−−−−−−−−−−ED−−−−−−−NRLSN−−−−LIPLCTPCH    
fig|456827.3.peg.1814   Cloacamonas acidaminovorans                 KWEEICEQIRQRD−−−N−−YHC−−−R−−NCG−−−−ATGD−−−−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IPFRRF−−−−−EDPAE−−−−−−−ANEPDN−−−−LVALCPRCH    
fig|556259.3.peg.4442   Bacteroides sp. D2                   QALRQLCLKHY−−−G−−YTC−−−Q−−VCGMNFEAVYG−−−−−−−−−KLGKNYIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−NPIA−−−−−−−−−−ETDG−−EHVLDPKTG−−−−LIPLCSNCH    
fig|537011.5.peg.2024   Prevotella copri DSM 18205                     LRQMCLDKY−−−G−−YQC−−−Q−−CCGMDFEETYG−−−−−−−−−KELGVNFME−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−RMIS−−−−−−−−TYETDGVPENFLE−−−N−−−−LVPLCSNCH    
fig|537011.5.peg.2940   Prevotella copri DSM 18205                     LRQMCLDKY−−−G−−YQC−−−Q−−CCGMDFEETYG−−−−−−−−−KELGVNFME−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−RMIS−−−−−−−−TYETDGVPENFLE−−−N−−−−LVPLCSNCH    
fig|478749.5.peg.1608   Bryantella formatexigens DSM 14469                    RLGKAAIKRS−−−G−−YKC−−−I−−FSTDA−−−−−−−−EPHKTFLKPDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−IPLK−−−−−−−−−−−QQPAFEYKLDTMAN−−−−LIPLCPLCHRR  
fig|525263.3.peg.286   Corynebacterium lipophiloflavum DSM 44291              SRFVNNAQFRALLAVW−−−G−−YEC−−−A−−MPGC−−−−−−−−−−−−−−−−−−NHTRFLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KEWA−−−−−−−−−−−NGGE−−−−−TNLEN−−−−LIPLCSACHSR  
fig|1191322.3.peg.3987   Vibrio tasmaniensis 1F-187                YRSEAIKLYAKKRA−−−N−−GLC−−−E−−GCGVP−−−−−−−−SPFET−−KSG−−PYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−TRLA−−−−−−−−−−−DGGA−−−−−DCPEN−−−−VIALCPTCHRK  
fig|314290.7.peg.1116   Vibrio sp. MED222                YRSEAIKLYAKKRA−−−N−−GLC−−−E−−GCGVP−−−−−−−−SPFET−−KSG−−PYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−TRLA−−−−−−−−−−−DGGA−−−−−DCPEN−−−−VIALCPTCHRK  
fig|88888881.3.peg.4205   Vibrio cholerae NRT36s                YRSEAIKLYAKKRA−−−N−−GVC−−−E−−ACGSK−−−−−−−−SPFET−−KTG−−PYIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−TRLA−−−−−−−−−−−DGGA−−−−−DCPEN−−−−VIALCPTCH    
fig|96561.5.peg.947   Desulfococcus oleovorans Hxd3                    KIRSFVIKRA−−−K−−GRC−−−E−−YCGEQ−−−−−−−−GFLM−−SDGQNYYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHI−−IALA−−−−−−−−−−−DEGE−−−−−DTVEN−−−−VIALCPKHHRE  
fig|96561.3.peg.919   Desulfococcus oleovorans Hxd3                    KIRSFVIKRA−−−K−−GRC−−−E−−YCGEQ−−−−−−−−GFLM−−SDGQNYYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHI−−IALA−−−−−−−−−−−DEGE−−−−−DTVEN−−−−VIALCPKHHRE  
fig|207559.7.peg.1224   Desulfovibrio desulfuricans subsp. desulfuricans str. G20                     VAARVLLRA−−−G−−GFC−−−E−−CCGAP−−−−−−−−APFVS−−RADNLPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−RPLA−−−−−−−−−−−EGGA−−−−−DTPAN−−−−CMALCPNCHRQ  
fig|207559.3.peg.1520   Desulfovibrio desulfuricans G20                     VAARVLLRA−−−G−−GFC−−−E−−CCGAP−−−−−−−−APFVS−−RADNLPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−RPLA−−−−−−−−−−−EGGA−−−−−DTPAN−−−−CMALCPNCHRQ  
fig|1078029.12.peg.2947   Escherichia coli O113:H21 str. CL-3                     VKAWILQQS−−−K−−GIC−−−E−−NCGKN−−−−−−−−APFYL−−NDGNPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−IPLS−−−−−−−−−−−SGGA−−−−−DTTDN−−−−CVALCPNCHRE  
fig|216595.4.peg.4905   Pseudomonas fluorescens SBW25                    KVRAWVLKEA−−−K−−GIC−−−E−−GCGSN−−−−−−−−APF−−−−EVDGLPFLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−KHLA−−−−−−−−−−−QKGS−−−−−DRISN−−−−AVALCPNCHQR  
fig|388401.3.peg.1440   Rhodobacterales bacterium HTCC2150                       AEVLFRA−−−N−−GTC−−−E−−GCRQS−−−−−−−−APFDR−−RSDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−IPLA−−−−−−−−−−−KDGH−−−−−DSVDN−−−−AVALCPNCHRR  
fig|667128.3.peg.1368   Pasteurella dagmatis ATCC 43325                       AEVLYQA−−−N−−GVC−−−G−−ACKKP−−−−−−−−APFNR−−KVDNMPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−IPLS−−−−−−−−−−−QNGD−−−−−DSVSN−−−−CIALCPNCHRK  
fig|675817.3.peg.3682   Photobacterium damselae subsp. damselae CIP 102761                       AEALIRA−−−A−−GIC−−−E−−ACGCQ−−−−−−−−APFNK−−KSNGEPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHL−−IPLS−−−−−−−−−−−KGGE−−−−−DSLDN−−−−VQSLCPNCHRK  
fig|634176.4.peg.956   Aggregatibacter aphrophilus NJ8700                       AEVLVRA−−−N−−GYC−−−E−−KCKKP−−−−−−−−APFIR−−KANLQPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IPLS−−−−−−−−−−−KDGE−−−−−DTVEN−−−−CMALCPNCHRQ  
fig|290318.4.peg.79   Prosthecochloris vibrioformis DSM 265                        EALHRA−−−E−−GFC−−−E−−NCKNP−−−−−−−−APFKR−−ASDGTPFLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−RSLS−−−−−−−−−−−DGGE−−−−−DTLEN−−−−VVALCPNCHRE  
fig|527028.3.peg.1298   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                       AEVLERA−−−N−−GYC−−−E−−ECKQE−−−−−−−−APFKR−−AKDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−IPLA−−−−−−−−−−−QGGE−−−−−DSVEN−−−−AVGLCPNCHRK  
fig|527022.3.peg.1741   Bacillus thuringiensis serovar monterrey BGSC 4AJ1                       AEVLERA−−−N−−GYC−−−E−−ECKQE−−−−−−−−APFKR−−AKDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−IPLA−−−−−−−−−−−QGGE−−−−−DSVEN−−−−AVGLCPNCHRK  
fig|526967.3.peg.5790   Bacillus cereus 172560W                       AEVLERA−−−N−−GYC−−−E−−ECKQE−−−−−−−−APFKR−−AKDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−VPLA−−−−−−−−−−−QGGE−−−−−DSVEN−−−−AVGMCPNCHRK  
fig|526982.3.peg.4846   Bacillus cereus Rock1-15                       AEILERA−−−N−−GYC−−−E−−ECGQE−−−−−−−−APFKR−−TKDGTPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−VPLS−−−−−−−−−−−EGGE−−−−−DTVEN−−−−ATALCPNCHRK  
fig|642492.3.peg.1088   Clostridium lentocellum DSM 5427                          LALA−−−K−−GKC−−−E−−KCGQE−−−−−−−−APFIS−−ALDGMPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KSIA−−−−−−−−−−−EGGE−−−−−DTVDN−−−−TIALCPNCHKE  
fig|1116127.3.peg.2262   Escherichia coli 2848050                       AEVLLRA−−−N−−GKC−−−Q−−YCKRD−−−−−−−−APFLK−−EDGTPFLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−EWLS−−−−−−−−−−−KGGE−−−−−DSVEN−−−−AIALCPNCHRQ  
fig|340184.6.peg.3223   Escherichia coli B7A                       AEVLLRA−−−N−−GKC−−−Q−−YCKRD−−−−−−−−APFLK−−EDGTPFLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−EWLS−−−−−−−−−−−KGGE−−−−−DSVEN−−−−AIALCPNCHRQ  
fig|869672.4.peg.857   Escherichia coli 97.0259                       AEVLLRA−−−N−−GKC−−−Q−−YCKRD−−−−−−−−APFLK−−EDGTPFLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−EWLS−−−−−−−−−−−KGGE−−−−−DSVEN−−−−AIALCPNCHRQ  
fig|247634.3.peg.3114   marine gamma proteobacterium HTCC2148             KYYERDPWISEYAKRRA−−−G−−GKC−−−Q−−LCESD−−−−−−−−APFIS−−KAGEPYLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−THHI−−EWLA−−−−−−−−−−−NGGE−−−−−DSISN−−−−TVALCPNCHRK  
fig|1138886.3.peg.549   Enterococcus faecium E0680         FSKTKIYKRNPFVSEYVKRLA−−−K−−GIC−−−Q−−LCQEK−−−−−−−−GPFIK−−−−DGVPYLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−EYLS−−−−−−−−−−−QGGK−−−−−DVIEN−−−−CIALCPNCHAR  
fig|645663.4.peg.1899   Enterococcus faecium E1039         FSKTKIYKRNPFVSEYVKRLA−−−K−−GIC−−−Q−−LCQEK−−−−−−−−GPFIK−−−−DGVPYLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−EYLS−−−−−−−−−−−QGGK−−−−−DVIEN−−−−CIALCPNCHAR  
fig|32049.15.peg.1544   Synechococcus sp. PCC 7002                 AWTRQIAPQVHAKF−−−D−−YIC−−−Q−−SCGQQGKQ−−−−−−−−−−−−−−−−−−LH−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHL−−VPVF−−−−−−−−ADKSL−−−−−−AYEFEN−−−−LVSLCQTCHQ   
fig|451707.4.peg.3728   Bacillus cereus NVH0597-99            TGEYQSW−−−RKMVFGRD−−−K−−YRC−−−Q−−CCG−−−−−−−−−−−−AKQGEVDFQVELH−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHHI−−−−−−−−−−−−−−−−INWKDCKELRYKVDN−−−−GITFCHDCHLK  
fig|526970.3.peg.2533   Bacillus cereus BGSC 6E1          KKKYYGPNWLMQRRRARKRD−−−Q−−YKC−−−Q−−ICG−−−−−−−−−−−−IHEKEYGQELSVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKKP−−−−−−−−−−−−−−−−FVYFESYEEANRLQN−−−−LISLCESCHRQ  
fig|572264.4.peg.1292   Bacillus cereus 03BB102          KKKYYGPNWLMQRRRARKRD−−−Q−−YKC−−−Q−−ICG−−−−−−−−−−−−IHEKEYGQELSVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKKP−−−−−−−−−−−−−−−−FVYFESYEEANRLQN−−−−LISLCESCHRQ  
fig|527028.3.peg.2402   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1          KKKYYGPNWLMQRRRARKRD−−−Q−−YKC−−−Q−−ICG−−−−−−−−−−−−IHEKEYGQELSVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKKP−−−−−−−−−−−−−−−−FVYFESYEEANRLQN−−−−LISLCESCHRQ  
fig|412694.5.peg.1224   Bacillus thuringiensis str. Al Hakam          KKKYYGPNWLMQRRRARKRD−−−Q−−YKC−−−Q−−ICG−−−−−−−−−−−−IHEKEYGQELSVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKKP−−−−−−−−−−−−−−−−FVYFESYEEANRLQN−−−−LISLCESCHRQ  
fig|323259.5.peg.1783   Methanospirillum hungatei JF-1                  WNVIRRQILERD−−−G−−YRC−−−Q−−ICGEQRDL−−−−−−−−−−−−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IPLS−−−−−−−−EGGDS−−−−−−T−−ASN−−−−LRVLCHSCHQQ  
fig|387093.6.peg.1233   Sulfurovum sp. NBC37-1                    RLRFRTFQND−−−N−−FKC−−−K−−NCG−−−−−−−−−−−−−−RSPATDPKTILH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−YPWSKGG−−−−−−−−−−−−−−−−ETVLEN−−−−LQTLCSDC     
fig|479437.5.peg.870   Eggerthella lenta DSM 2243                     MRYNVLRRD−−−D−−FHC−−−V−−RCG−−−−RGREDGV−−−−−−−−−−K−−LH−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−VPVSRGG−−−−KSVMS−−−−−−−−−−−−N−−−−LQTLCEDC     
fig|445972.6.peg.1940   Anaerotruncus colihominis DSM 17241                   KDMKRAVLERD−−−N−−MKC−−−A−−VCG−−−−KYLTSCKDIERFLKLGQGLYH−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−APVLQGGR−−−−−−−−−−−−−−−AAIEN−−−−LRLICPEC     
fig|513049.3.peg.2099   Arthrospira maxima CS-328                     LRRLVIQRA−−−N−−NRC−−−E−−YCG−−−−−−−−−−−−ISQVGQ−−VATFH−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPVVAGGE−−−−−−−−−−−−−−TTADN−−−−LDLACVSC     
fig|513049.3.peg.2110   Arthrospira maxima CS-328                     LRRLVIQRA−−−N−−NRC−−−E−−YCG−−−−−−−−−−−−ISQVGQ−−VATFH−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPVVAGGE−−−−−−−−−−−−−−TTADN−−−−LDLACVSC     
fig|553201.3.peg.293   Rothia mucilaginosa ATCC 25296                     LRQRIKERD−−−NYTCQN−−−P−−GCG−−−−−−−−−−−−NSIMRERILILE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVHK−−VPLSEGGN−−−−−−−−−−−−−−NEPDN−−−−LQTLCWRC     
fig|680646.3.peg.1147   Rothia mucilaginosa DY-18                     LRQRIKERD−−−NYTCQN−−−P−−GCG−−−−−−−−−−−−NSIMRERILILE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVHK−−IPLSEGGN−−−−−−−−−−−−−−NEPEN−−−−LQTLCWRC     
fig|386415.6.peg.859   Clostridium novyi NT     KFKKSAAGQRALMTSKLREKIKKRD−−−N−−YTC−−−Q−−KCG−−−−LSTRDEK−−−−−−−−−−NLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPISKGG−−−−MSTEK−−−−−−−−−−−−N−−−−LQTLCWKCNRK  
fig|259536.4.peg.352   Psychrobacter sp. 273-4                    KLREEIKERD−−−S−−YAC−−−K−−ICN−−−−LSTSDEA−−−−−−−−−−NLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLSKGG−−−−VTCES−−−−−−−−−−−−N−−−−LQTLCWKC     
fig|1051629.3.peg.3461   Mycobacterium avium subsp. paratuberculosis JQ5     RWRKSAAGQRALMTSRLRNSIKVRD−−−H−−YTC−−−R−−YCS−−−−VSLAAEP−−−−−−−−−−HLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−VPISKGG−−−−MSTPD−−−−−−−−−−−−N−−−−LQTLCWRC     
fig|487214.5.peg.393   Streptococcus pneumoniae Hungary19A-6                    KLRTQIKERD−−−H−−YTC−−−Q−−ICA−−−−ASTAEQS−−−−−−−−−−LLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPVSKGG−−−−LSTPD−−−−−−−−−−−−N−−−−LQTLCWKC     
fig|760797.3.peg.451   Streptococcus pneumoniae GA19077                    KLRTQIKERD−−−H−−YTC−−−Q−−ICA−−−−ASTAEQS−−−−−−−−−−LLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPVSKGG−−−−LSTPD−−−−−−−−−−−−N−−−−LQTLCWKC     
fig|487214.3.peg.381   Streptococcus pneumoniae Hungary19A-6                    KLRTQIKERD−−−H−−YTC−−−Q−−ICA−−−−ASTAEQS−−−−−−−−−−LLLLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−VPVSKGG−−−−LSTPD−−−−−−−−−−−−N−−−−LQTLCWKC     
fig|314278.3.peg.2428   Nitrococcus mobilis Nb-231                    KLRFEILRRD−−−G−−YRC−−−Q−−LCG−−−−LSASDRA−−−−−−−−−−SVRLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHK−−VAVVKGG−−−−TNDPE−−−−−−−−−−−−N−−−−LWVLCRKC     
fig|321327.20.peg.1137   Synechococcus sp. JA-3-3Ab                     VREYVFQRD−−−G−−FRC−−−R−−GCG−−−−KSPPEV−−−−−−−−−−Q−−LQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPIAQGG−−−−SNDIS−−−−−−−−−−−−N−−−−LQTLCKTC     
fig|321332.11.peg.2649   Synechococcus sp. JA-2-3B'a(2-13)                     VREYVFQRD−−−G−−FRC−−−R−−GCG−−−−KSPPEV−−−−−−−−−−Q−−LQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPIAQGG−−−−SNDIS−−−−−−−−−−−−N−−−−LQTLCKTC     
fig|465543.3.peg.1856   Streptomyces sp. SPB74                   RGVRALVLDRD−−−G−−WQC−−−R−−HCG−−−−WQPGDPVPAAPTGRPLARCLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHV−−HPRSRGG−−−−SDDVS−−−−−−−−−−−−N−−−−LQVLCTSC     
fig|1148.35.peg.1354   Synechocystis sp. PCC 6803                     VREYVFRRD−−−N−−YRC−−−R−−ACG−−−−CSHNET−−−−−−−−−−A−−LQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−IPLARGG−−−−SNDMS−−−−−−−−−−−−N−−−−LQTLCQSC     
fig|391612.5.peg.3490   Cyanothece sp. CCY0110                   KSVRDYVFNRD−−−N−−YQC−−−R−−SCG−−−−KKQQET−−−−−−−−−−T−−LN−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLAKGG−−−−SNDMS−−−−−−−−−−−−N−−−−LQTLCHTCNQQ  
fig|497965.6.peg.3999   Cyanothece sp. PCC 7822                     VRKYVYQRD−−−N−−YQC−−−R−−SCG−−−−KTATET−−−−−−−−−−S−−LN−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLAKGG−−−−SNDIS−−−−−−−−−−−−N−−−−LQTLCQTCNQR  
fig|203124.6.peg.5115   Trichodesmium erythraeum IMS101                    SVKKYVFERD−−−N−−YHC−−−Q−−SCG−−−−KSSTQT−−−−−−−−−−E−−LS−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLARGG−−−−SNDIS−−−−−−−−−−−−N−−−−LQTLCQKCNKK  
fig|63737.11.peg.7391   Nostoc punctiforme PCC 73102                     VKKYVFERD−−−K−−YQC−−−Q−−SCG−−−−KTTTET−−−−−−−−−−H−−IS−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLARGG−−−−QNDIS−−−−−−−−−−−−N−−−−LQTLCLTCNQQ  
fig|313612.3.peg.618   Lyngbya sp. PCC 8106                   QTVRKYVFERD−−−S−−YCC−−−Q−−SCQ−−−−KTNLET−−−−−−−−−−E−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLAKGG−−−−SNDIS−−−−−−−−−−−−N−−−−LQTLCRSC     
fig|118168.3.peg.5658   Microcoleus chthonoplastes PCC 7420                     VRNYVFERD−−−N−−YQC−−−K−−SCG−−−−KTHLDT−−−−−−−−−−Q−−LQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLARGG−−−−QNDIS−−−−−−−−−−−−N−−−−LQTLCRSC     
fig|513049.3.peg.2316   Arthrospira maxima CS-328                     VRKYVYERD−−−N−−FTC−−−Q−−SCG−−−−KTNKEA−−−−−−−−−−R−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IALARGG−−−−SNDLS−−−−−−−−−−−−N−−−−LQTLCWECNRK  
fig|103690.10.peg.1020   Nostoc sp. PCC 7120                     VRQYVFQRD−−−K−−FQC−−−Q−−SCG−−−−KTGLET−−−−−−−−−−N−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLARGG−−−−QNDIS−−−−−−−−−−−−N−−−−LHTLCFDC     
fig|240292.3.peg.4220   Anabaena variabilis ATCC 29413                     VRQYVFQRD−−−K−−FQC−−−Q−−SCG−−−−KTGLEA−−−−−−−−−−D−−LT−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IPLARGG−−−−QNDMS−−−−−−−−−−−−N−−−−LHTLCFDCNRR  
fig|682795.3.peg.2585   Acidobacterium sp. MP5ACTX8                     LRDQVFARD−−−−−−RGI−−−−CTDCG−−−−−−−−−−−−−−−TDTVAAYAALKRSRGKARVEALAVWGLKTVQARRSLWDADHI−−RPVAEGGGQC−−−−−−−−−−−−−−−DLDN−−−−LRTLCLPCHRE  
fig|400667.4.peg.1656   Acinetobacter baumannii ATCC 17978                RPWRRLKAKIHLRD−−−E−−WTC−−−Q−−CC−−−−−−−GIVTK−−−−−−−−−−−−DLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHI−−MNVARGG−−−−TDDES−−−−−−−−−−−−N−−−−LQSLCVPCHKK  
fig|465543.3.peg.440   Streptomyces sp. SPB74              SSGRWRTLKRVAG−−RD−−−G−−EYC−−−Y−−RCG−−−−−−−−AEQPSAEDDPDGELRLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHI−−TPVSEGGA−−−−−−−−−−−−−−−VDDPEN−−−−LGLICVPCH    
fig|351746.4.peg.4065   Pseudomonas putida F1                                     YTC−−−R−−AC−−−−−−−GLVTK−−−−−−−−−−−−DLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−INVAEGG−−−−SDDDS−−−−−−−−−−−−N−−−−LQALCVPCHQE  
fig|641147.3.peg.572   Simonsiella muelleri ATCC 29453                RPWRRLRDAVLARD−−−N−−YTC−−−Q−−HCK−−−−RVCLPE−−−−−−−−−−−−NLC−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADHI−−INKARGG−−−−GDDLS−−−−−−−−−−−−N−−−−LQTLCTECHK   
fig|546264.5.peg.1497   Neisseria flavescens NRL30031/H210                RSWMSLRESVLIRD−−−Q−−YQC−−−R−−QCG−−−−RVVLPS−−−−−−−−−−−−DAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−CDHI−−VPLADGG−−−−ADDVE−−−−−−−−−−−−N−−−−LQTLCKDCH    
fig|526982.3.peg.3734   Bacillus cereus Rock1-15          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGSVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HYPEL−−−−−−ALEIDN−−−−LETICVDCHNK  
fig|526987.3.peg.5025   Bacillus cereus Rock4-2          RKFYDSGEWKSIREQVKKKD−−−N−−YEC−−−Q−−ECKRNGSVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HYPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|1053238.3.peg.526   Bacillus cereus VD154          RKFYDSVEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGSVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KEIE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|527027.3.peg.3149   Bacillus thuringiensis serovar pakistani str. T13001          RKFYDSVEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGSVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KEIE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|526967.3.peg.100   Bacillus cereus 172560W          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGSVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|526988.3.peg.177   Bacillus cereus Rock4-18          RKFYDSGEWKSIREHVKKRD−−−N−−YEC−−−Q−−ECKRNGHVRVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEMEN−−−−LETVCVDCHNK  
fig|1217737.3.peg.3455   Bacillus thuringiensis HD-789          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRKGRVRIDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIEN−−−−LETVCVDCHNK  
fig|527020.3.peg.4093   Bacillus thuringiensis IBL 4222          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRKGRVRIDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIEN−−−−LETVCVDCHNK  
fig|526969.3.peg.2274   Bacillus cereus m1550          RKFYDSGEWKNLREQVKKRD−−−N−−YEC−−−Q−−ACKRNGHVYVDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|1324966.3.peg.4979   Bacillus thuringiensis T01-328          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGCVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|541229.3.peg.3888   Bacillus thuringiensis serovar chinensis CT-43          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGCVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|1053177.3.peg.2458   Bacillus cereus BAG2O-2          RKFYDSGEWKQLREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDYHNK  
fig|526981.3.peg.2900   Bacillus cereus Rock1-3          RKFYDSGEWKQLREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDYHNK  
fig|526979.3.peg.2944   Bacillus cereus 95/8201          RKFYDSGEWKQLREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALDKDN−−−−LETVCVDCHNK  
fig|1218175.3.peg.5649   Bacillus thuringiensis HD-771          RKFYDSGAWKQLREQVKKRD−−−S−−NEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEKDN−−−−LETVCVDCHNK  
fig|527026.3.peg.3555   Bacillus thuringiensis serovar sotto str. T04001          RKFYDSGAWKQLREQVKKRD−−−S−−NEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEKDN−−−−LETVCVDCHNK  
fig|526968.3.peg.3787   Bacillus cereus R309803          RKFYDSGAWKQLREQVKKRD−−−N−−NEC−−−Q−−ECKRNGRVQTDTNEYSEKAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|1053215.3.peg.282   Bacillus cereus ISP2954          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|527023.3.peg.1944   Bacillus thuringiensis serovar kurstaki str. T03a001          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|714359.3.peg.2503   Bacillus thuringiensis BMB171          RKFYDSGEWKSIREQVKKRD−−−S−−YEC−−−Q−−QCKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|526990.3.peg.5590   Bacillus cereus AH603          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEHSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|527019.3.peg.999   Bacillus thuringiensis IBL 200          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPAL−−−−−−ALEIDN−−−−LETVCVDCHNK  
fig|1053215.3.peg.6277   Bacillus cereus ISP2954          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPAL−−−−−−ALEIDN−−−−LETICVDCHNK  
fig|527023.3.peg.2128   Bacillus thuringiensis serovar kurstaki str. T03a001          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPAL−−−−−−ALEIDN−−−−LETICVDCHNK  
fig|527030.3.peg.5190   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1          RKFYDNGEWKSIREQVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDNNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEINN−−−−LETVCVDCHNK  
fig|526980.3.peg.4834   Bacillus cereus ATCC 10876          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−Q−−GCKRNGRVQTDNNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALEINN−−−−LETVCVDCHNK  
fig|526983.3.peg.4879   Bacillus cereus Rock3-28          RKFYDCGEWKSIREPVKKRD−−−N−−YEC−−−Q−−ECKRNGRVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HHPEL−−−−−−ALDIDN−−−−LETVCVNCHNK  
fig|405531.7.peg.3786   Bacillus cereus G9842          RKFYDSGEWKSIREQVKKRD−−−N−−YEC−−−K−−ECKRNGQVQTDTNEYSESAKRKKIQLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELE−−−−−−−−HYPDL−−−−−−ALDIDN−−−−LETVCVNCHNK  
fig|393121.3.peg.3164   Listeria monocytogenes FSL J2-071          HTFYKSKEWASIRKEVLKRD−−−N−−YEC−−−Q−−ECKRQGKVFTD−−−YHEPDKHKRLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KDLE−−−−−−−−HHPEL−−−−−−ALDIDN−−−−LTTLCVKCHNK  
fig|553567.3.peg.1838   Staphylococcus aureus A5948           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KRKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|553581.3.peg.336   Staphylococcus aureus A9299           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KRKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|585153.3.peg.2598   Staphylococcus aureus subsp. aureus E1410           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KRKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|931438.3.peg.1657   Staphylococcus aureus subsp. aureus CIG1605           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KRKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|869816.3.peg.1992   Staphylococcus aureus subsp. aureus JKD6159           RFYKSKEWQITRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KRKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|585155.3.peg.2576   Staphylococcus aureus subsp. aureus H19           RFYKSKEWQTTRKRILERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KHKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|1158536.3.peg.311   Staphylococcus aureus M0571           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KHKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|904783.3.peg.578   Staphylococcus aureus subsp. aureus IS-122           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KHKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|931446.3.peg.2462   Staphylococcus aureus subsp. aureus CIG1213           RFYKSKEWQTTRKRVLERD−−−N−−YEC−−−Q−−QCKRDGKLTT−−−−YDKS−−KHKSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−LSLE−−−−−−−−HHPEF−−−−−−AHDLNN−−−−LETLCIKCHNK  
fig|333990.5.peg.862   Carnobacterium sp. AT7          DAFYQNQTWRNKRKEILRRD−−−N−−NEC−−−Q−−VTKSLGGV−−−−−−−−−−−−−−DKDKLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KPLE−−−−−−−−YYPEL−−−−−−AMDDSN−−−−LITVSHTNHN   
fig|525378.3.peg.330   Staphylococcus epidermidis M23864:W1          RTFYNSMAWRDKRSEVMQRD−−−H−−FEC−−−Q−−RCKRLGKVTIDELEIKKNNRKKIKLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELA−−−−−−−−DHPEY−−−−−−ALDSDN−−−−LETLCVECHNE  
fig|979222.3.peg.636   Staphylococcus epidermidis NIH04008           KFYHSTDWNQLRMKAYLRD−−−N−−REC−−−Q−−HCKAEGKV−−−−−−−−−−−−−−VKGQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−QPID−−−−−−−−LRPDL−−−−−−ALNIDN−−−−LITLCIDCHNK  
fig|526979.3.peg.385   Bacillus cereus 95/8201          MKFYKSKEWNALRLIAIQRA−−−K−−NEC−−−E−−HCKRKGKVTTRETLDKRG−−−−RKMKMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNHI−−KPVK−−−−−−−−THPHL−−−−−−ALNVDN−−−−LEYLCVRCHN   
fig|526971.3.peg.507   Bacillus cereus MM3          MKFYKSKEWRALRLKAIDRA−−−K−−SEC−−−E−−HCKQEGKVTTRDTLDERG−−−−RKTKMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNHI−−KPVK−−−−−−−−THPHL−−−−−−ALELDN−−−−LEYICVRHHN   
fig|1218175.3.peg.1428   Bacillus thuringiensis HD-771          MKFYKSKEWRALRLKAIERA−−−K−−NEC−−−E−−HCKQKGKVTTRDTLDKRG−−−−RKMKMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNHI−−KPVK−−−−−−−−TYPHL−−−−−−ALDLDN−−−−LEYLCVRCHN   
fig|527026.3.peg.1034   Bacillus thuringiensis serovar sotto str. T04001          MKFYKSKEWRALRLKAIERA−−−K−−NEC−−−E−−HCKQKGKVTTRDTLDKRG−−−−RKMKMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNHI−−KPVK−−−−−−−−TYPHL−−−−−−ALDLDN−−−−LEYLCVRCHN   
fig|515621.3.peg.1619   Clostridium botulinum Ba4 str. 657          SKFYKTYKWVKKRQEVLIRD−−−N−−FEC−−−Q−−ECKKQGR−−−−−−−FRPAD−−−−−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KELK−−−−−−−−QYPEL−−−−−−ALDINN−−−−LTSLCNRCHN   
fig|1053222.3.peg.4912   Bacillus cereus MSX-D12          MKFYKSREWRELRLKALKRD−−−N−−FEC−−−C−−MCRDKGK−−−−−−−YRKAD−−−−−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KEVK−−−−−−−−EYPEL−−−−−−ALTFDN−−−−LMSLCNTCHNE  
fig|405535.8.peg.535   Bacillus cereus AH820          MKFYKSREWRELRLKALKRD−−−N−−FEC−−−C−−MCRDKGK−−−−−−−YRKAD−−−−−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KEVK−−−−−−−−EYPEL−−−−−−ALTFDN−−−−LMSLCNTCHNE  
fig|401650.3.peg.3093   Listeria monocytogenes Aureli 1997          MKFYKCKEWLSLRQEALKRD−−−N−−YEC−−−Q−−RCKKKGK−−−−−−−−−−−−−−−QRQADC−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KYVK−−−−−−−−EFPAF−−−−−−ALTLSN−−−−LECLCNQCHNE  
fig|445337.5.peg.1551   Clostridium botulinum C str. Eklund          KAFYNSSQWLSKRAEALERD−−−N−−NEC−−−Q−−KCKAKGLY−−−−−−−−−−−−−−−TEANC−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−EHVR−−−−−−−−KRPDL−−−−−−ALTLSN−−−−LISLCNSCHDE  
fig|441770.6.peg.2882   Clostridium botulinum A str. ATCC 19397            FYKSTNWINKRKQILKRD−−−N−−KEC−−−Q−−RCKANGGY−−−−−−−−−−−−−−HKAEC−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−KHLR−−−−−−−−DRPDL−−−−−−ALTDSN−−−−LISLCYTCHNE  
fig|349161.4.peg.2567   Desulfotomaculum reducens MI-1          HGFYTSSPWLNVRFEVLQEFK−−−−−−FEC−−−Q−−HCK−−−−−−−−−−−−−−−−ARGFYKKADT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−QYVK−−−−−−−−KYPRLALSKTYIDNEGNVKLNLVPLCHGCH    
fig|1289590.3.peg.943   Clostridium botulinum CB11/1-1          HGFYVSTPWKHLRKEMLNEQ−−−N−−SEC−−−Q−−MCKAKGK−−−−−−−−−−−−−−−YSAATT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−KHVN−−−−−−−−KHPEL−−−−−−ALTRSN−−−−LMCVCKECHNE  
fig|508767.4.peg.2044   Clostridium botulinum E3 str. Alaska E43          HGFYVSTPWKHLRKEMLNEQ−−−N−−SEC−−−Q−−MCKAKGK−−−−−−−−−−−−−−−YSAATT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−KHVN−−−−−−−−KHPEL−−−−−−ALTRSN−−−−LMCVCKECHNE  
fig|508765.6.peg.2176   Clostridium botulinum B str. Eklund 17B          HGFYVSTPWKHLRKEMLKEQ−−−N−−SEC−−−Q−−MCKAKGK−−−−−−−−−−−−−−−YSAATT−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHV−−KHVN−−−−−−−−KHPEL−−−−−−ALTRSN−−−−LMCVCKECHNE  
fig|279808.3.peg.1505   Staphylococcus haemolyticus JCSC1435          KGFYSNARWRKTRLKVLARD−−−H−−YEC−−−V−−MCNAEGRL−−−−−−−−−−−TINQKQSLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−IELE−−−−−−−−KQPEL−−−−−−AYDLNN−−−−LRTLCKYHHNK  
fig|198466.1.peg.2026   Streptococcus pyogenes MGAS315          RTFYHKTEWRKLREIAIIRD−−−K−−REC−−−I−−WCRQNGKR−−−−−−−−−−−−−−TTTNLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KEVK−−−−−−−−DYPEL−−−−−−ALDLAN−−−−LRTLCKDCHNR  
fig|198538.1.peg.28   Streptococcus pyogenes phage 315.1          RTFYHKTEWRKLREIAIIRD−−−K−−REC−−−I−−WCRQNGKR−−−−−−−−−−−−−−TTTNLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KEVK−−−−−−−−DYPEL−−−−−−ALDLAN−−−−LRTLCKDCHNR  
fig|193567.1.peg.1144   Streptococcus pyogenes SSI-1          RTFYHKTEWRKLREIAIIRD−−−K−−REC−−−I−−WCRQNGKR−−−−−−−−−−−−−−TTTNLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KEVK−−−−−−−−DYPEL−−−−−−ALDLAN−−−−LRTLCKDCHNR  
fig|272620.3.peg.260   Klebsiella pneumoniae MGH 78578          DTFYRSREWRRLRYQAFQRY−−−G−−NKC−−−C−−VCG−−−−−−−−−−−−RGANDGMVM−−−H−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KPRSLYPHL−−−−−−−−−−−−−−ALDIAN−−−−LQIMCNEC     
fig|497965.6.peg.6815   Cyanothece sp. PCC 7822        KWKGSKDGQDWKQKQYAIQQ−−−−−−−−GLC−−−A−−MC−−−−−−−−−−−−−−−−KKSMPLIGSH−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHI−−KPISTHPQL−−−−−−−−−−−−−−ALDVSN−−−−LRLLCPAC     
fig|460265.11.peg.380   Methylobacterium nodulans ORS 2060          QGFYWSDEWRAVRYQALKLH−−−G−−GAC−−−Q−−CCG−−−−−−−−−−−−ARGTKRAPL−−−H−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−KPRSRYPHL−−−−−−−−−−−−−−ALEISN−−−−LQVLCEDC     
fig|272943.3.peg.1901   Rhodobacter sphaeroides 2.4.1               TRRWKVLRHQILERD−−−G−−WAC−−−T−−ECGKRGRL−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHK−−KPVR−−−−−−−−TAPEL−−−−−−SFDPSN−−−−LTSLCPACHTR  
fig|318586.5.peg.2569   Paracoccus denitrificans PD1222              KTKRWQVLRQIVLERD−−−G−−WAC−−−V−−DCGTKRGRL−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHV−−KPVR−−−−−−−−THPHL−−−−−−AFDPGN−−−−CATRCSSCHTR  
fig|52598.3.peg.2165   Sulfitobacter sp. EE-36               TKRWQVLRAEILERD−−−R−−YRC−−−C−−SCGCGGRL−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHV−−KPVR−−−−−−−−THPEL−−−−−−SYEPRN−−−−LQALCPSCHTR  
fig|348780.3.peg.791   Natronomonas pharaonis DSM 2160                 RWRVIREEVLERD−−−D−−YTC−−−Q−−RCGYEQEAESGEPSKRLEAHFADAHGSPS−−−−−−−−−−−−−−−−−−−−−−−−−−−LEQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DR−−−−LVTVCGPCH    
fig|64091.1.peg.2533   Halobacterium sp. NRC-1                  WKERREQVLERD−−−N−−RTC−−−Q−−GCG−−−−RSENELG−−−−−−−−−−−YTPR−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−RPFAEFD−−−−EDEVEA−−−−−−AHDPSN−−−−LVSLCEPCHTR  
fig|1081943.3.peg.5780   Bacillus anthracis str. Heroin Ba4599                 EFQKLRKRVIDRD−−−A−−GHC−−−Q−−RC−−−−−−−−−−−−−RIKFGLMNFDDLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−KSWR−−−−−−−−DYPDL−−−−−−AYDELN−−−−LITICRHC     
fig|261594.1.peg.5265   Bacillus anthracis str. 'Ames Ancestor'                 EFQKLRKRVIDRD−−−A−−GHC−−−Q−−RC−−−−−−−−−−−−−RIKFGLMNFDDLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−KSWR−−−−−−−−DYPDL−−−−−−AYDELN−−−−LITICRHC     
fig|1213182.3.peg.4385   Bacillus anthracis str. BF1                 EFQKLRKRVIDRD−−−A−−GHC−−−Q−−RC−−−−−−−−−−−−−RIKFGLMNFDDLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−KSWR−−−−−−−−DYPDL−−−−−−AYDELN−−−−LITICRHC     
fig|260799.1.peg.4926   Bacillus anthracis str. Sterne                 EFQKLRKRVIDRD−−−A−−GHC−−−Q−−RC−−−−−−−−−−−−−RIKFGLMNFDDLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−KSWR−−−−−−−−DYPDL−−−−−−AYDELN−−−−LITICRHC     
fig|260799.14.peg.5314   Bacillus anthracis str. Sterne                 EFQKLRKRVIDRD−−−A−−GHC−−−Q−−RC−−−−−−−−−−−−−RIKFGLMNFDDLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHHI−−KSWR−−−−−−−−DYPDL−−−−−−AYDELN−−−−LITICRHC     
fig|316274.3.peg.5339   Herpetosiphon aurantiacus ATCC 23779                KAWEQIRQEVLQMS−−−N−−YTC−−−Q−−HCGT−−RV−−−−−−−−−−−−−−HRSTAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHR−−IPLKRFT−−−−RRQTAH−−−−−−KLE−−N−−−−LQCLCRACH    
fig|316274.7.peg.5388   Herpetosiphon aurantiacus ATCC 23779                KAWEQIRQEVLQMS−−−N−−YTC−−−Q−−HCGT−−RV−−−−−−−−−−−−−−HRSTAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDHR−−IPLKRFT−−−−RRQTAH−−−−−−KLE−−N−−−−LQCLCRACH    
fig|596319.3.peg.2227   Staphylococcus warneri L37603          KRFYNSKSWEDVRQQVLKRD−−−N−−YEC−−−T−−WCREEGKV−−−−−−−−−−−−−−TTTGLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDH−−−−−IQELQ−−−−DRPDL−−−−−−−KLEPDN−−−−LRTLCKACHNK  
fig|460265.11.peg.342   Methylobacterium nodulans ORS 2060                   RAWRLAVLQRA−−−G−−WCC−−−E−−DCG−−−−A−−−−−−QGGR−−−−GGVRLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADHV−−IERQDGGA−−−−−−−−−−−−−−−LTDPNN−−−−GRCLCGSCHTR  
fig|460265.11.peg.5679   Methylobacterium nodulans ORS 2060                   RAWRLAVLQRA−−−G−−WRC−−−E−−DCG−−−−A−−−−−−QGGR−−−−GGVRLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADHV−−IERQDGGE−−−−−−−−−−−−−−−LTDPNN−−−−GRCLCGSCHTR  
fig|460265.11.peg.4727   Methylobacterium nodulans ORS 2060                   RAWRLAVLQRA−−−G−−WRC−−−E−−DCG−−−−A−−−−−−QGGR−−−−GGVRLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADHV−−IERQDGGA−−−−−−−−−−−−−−−LTDPSN−−−−GRCLCGSCHSR  
fig|244592.3.peg.5085   Labrenzia alexandrii DFL-11            FYQSAGWRALAADIKRQR−−−R−−YRC−−−E−−ACG−−−−S−−−−−−DFSR−−−−RADKLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADHI−−VERSAGGA−−−−−−−−−−−−−−−EFDPLN−−−−IQCLCIACHN   
fig|634457.3.peg.2109   Acetobacter pasteurianus IFO 3283-32          DGFYTSPEWRALMASIKRKR−−−P−−HCC−−−E−−QCG−−−−−−−−−−−−−−R−−−−TGTRLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDHI−−QELKDGGA−−−−−−−−−−−−−−−PLDENN−−−−IQLLCGSCH    
fig|485913.3.peg.4915   Ktedonobacter racemifer DSM 44963                AEWRALRRQKLEAA−−−G−−YRC−−−E−−ECG−−−−VLDRSVMKSAR−−−−TGEDYMV−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLSI−−AHKKQYQT−−−−−−−−−−−−−−−WLHEAE−−−−TMVLCQRCHRR  
fig|488538.3.peg.1377   alpha proteobacterium IMCC1322                     LRYEILKRA−−−K−−FRC−−−E−−LCG−−−−ISADQKA−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−VPRNSGG−−−−GDEQS−−−−−−−−−−−−N−−−−LQALCYSC     
fig|221360.4.peg.2263   Synechococcus sp. RS9917                    SIRYRVFTRA−−−K−−GRC−−−E−−CCG−−−−AHEHQAA−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−IPKNHGG−−−−SDDIS−−−−−−−−−−−−N−−−−FQALCFRC     
fig|221360.3.peg.2449   Synechococcus sp. RS9917                    SIRYRVFTRA−−−K−−GRC−−−E−−CCG−−−−AHEHQAA−−−−−−−−−−−−−LE−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDHI−−IPKNHGG−−−−SDDIS−−−−−−−−−−−−N−−−−FQALCFRC     
fig|931446.3.peg.85   Staphylococcus aureus subsp. aureus CIG1213          DWFYHSKAWKKLREIALDRD−−−N−−YLC−−−Q−−MCLREDIV−−−−−−−−−−−−−−−TDANI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VHHI−−IYVD−−−−−−−−EDFNK−−−−−−ALDLDN−−−−LMSVCYSCHNK  
fig|548473.3.peg.1821   Staphylococcus aureus subsp. aureus TCH60          DWFYHSKAWKKLREIALDRD−−−N