(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020586

fig|553594.3.peg.69   Staphylococcus aureus A9765                            MAGPQQREIGSPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGGAQ−−−−−−−−−−−−−−−−−−−HRSWRKVSIQKCASWRGPNREK      
fig|452948.4.peg.693   Staphylococcus aureus 930918-3                            MTGPQQREIGSPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGGAQ−−−−−−−−−−−−−−−−−−−HRSWRKVSIQKCASWRGPNREK      
fig|762962.3.peg.906   Staphylococcus aureus subsp. aureus ATCC 51811                            MAGPQHREIGSPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGGAQ−−−−−−−−−−−−−−−−−−−HRSWRKVSIQKCASWRGHNREK      
fig|273036.3.peg.1319   Staphylococcus aureus RF122                               GPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGGPQ−−−−−−−−−−−−−−−−−−−HRSCRKVSLQQCASWRGPNIKKYFFFRN
fig|273036.6.peg.725   Staphylococcus aureus RF122      MRV−−−−−−−−−−−−−−−−−−−−GGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STNN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IKKYF                        
fig|273036.3.peg.453   Staphylococcus aureus RF122      MCE−−−−−−−−−−−−−−−−−−−LAGSQHREIGTAI−−−−−−−−−−−−−−−−−−−SRNN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKIFYRQCRLG             
fig|585152.3.peg.253   Staphylococcus aureus subsp. aureus D139                            MAGPNKEKFGTTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYKQCKLG             
fig|585155.3.peg.577   Staphylococcus aureus subsp. aureus H19                            MAGPNKEKFGTTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYKQCKLG             
fig|546342.4.peg.256   Staphylococcus aureus subsp. aureus str. JKD6008      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKL              
fig|585143.3.peg.530   Staphylococcus aureus subsp. aureus 55/2053      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKL              
fig|585156.3.peg.2616   Staphylococcus aureus subsp. aureus M1015      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKL              
fig|585157.3.peg.2673   Staphylococcus aureus subsp. aureus M809      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKL              
fig|585150.3.peg.353   Staphylococcus aureus subsp. aureus C160      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKLG             
fig|585151.3.peg.2147   Staphylococcus aureus subsp. aureus C427      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKLG             
fig|585160.3.peg.1791   Staphylococcus aureus subsp. aureus WBG10049      MCE−−−−−−−−−−−−−−−−−−−LAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYRQCKLG             
fig|553590.4.peg.2048   Staphylococcus aureus A9754      MQV−−−−−−−−−−−−−−−−−−−GDGPQHREIGSVI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYKQCKLAGPQ          
fig|548474.3.peg.1741   Staphylococcus aureus subsp. aureus TCH130                                PQHREIGSVI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IENFEKKFYKQCKLG             
fig|282459.5.peg.1885   Staphylococcus aureus subsp. aureus MSSA476        M−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKKFYRQCELG             
fig|426430.8.peg.1986   Staphylococcus aureus subsp. aureus str. Newman        M−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKKFYRQSELG             
fig|553590.4.peg.1502   Staphylococcus aureus A9754        M−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKKFYRQSELG             
fig|585150.3.peg.2491   Staphylococcus aureus subsp. aureus C160        M−−−−−−−−−−−−−−−−−−−−AGPQHREIGSTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKRNSTGNAGWGVGPNTEKLEHQFL
fig|931453.3.peg.2625   Staphylococcus aureus subsp. aureus CIG149        M−−−−−−−−−−−−−−−−−−−−AGPQHREIGSTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKRNSTGNAGWGVGPNTEKLEHQFL
fig|585156.3.peg.1440   Staphylococcus aureus subsp. aureus M1015     MCRL−−−−−−−−−−−−−−−−−−−−AGPQHREIGSTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKRNSTGNASWG             
fig|585147.3.peg.1420   Staphylococcus aureus subsp. aureus A017934/97     MCRL−−−−−−−−−−−−−−−−−−−−AGPQHREIGSTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKRNSTGNAGWGVGPNTEKLEHQFL
fig|585151.3.peg.1578   Staphylococcus aureus subsp. aureus C427     MCRL−−−−−−−−−−−−−−−−−−−−AGPQHREIGSTI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TENFEKRNSTGNAGWGVGPNTEKLEHQFL
fig|273036.3.peg.1047   Staphylococcus aureus RF122      VQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASRRGPN−−−−−−−−−−−−−−−−−−−TEA                          
fig|273036.6.peg.990   Staphylococcus aureus RF122      VQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASRRGPN−−−−−−−−−−−−−−−−−−−TEA                          
fig|553601.3.peg.2291   Staphylococcus aureus A10102      VQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSVYNNVQVGVGRR         
fig|1158512.3.peg.1278   Staphylococcus aureus M0154      MQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSVYNNVQVGVGRR         
fig|1158520.3.peg.514   Staphylococcus aureus M0280      MQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSVYNNVQVGVGRR         
fig|359786.3.peg.708   Staphylococcus aureus subsp. aureus JH9      MQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSVYNNVQVGVGRR         
fig|553596.3.peg.2525   Staphylococcus aureus A9781      MQV−−−−−−−−−−−−−−−−−−−GDGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSVYNNVQVGVGRR         
fig|426430.8.peg.902   Staphylococcus aureus subsp. aureus str. Newman      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|451515.3.peg.953   Staphylococcus aureus subsp. aureus USA300_FPR3757      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|452948.4.peg.1270   Staphylococcus aureus 930918-3      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|546342.4.peg.964   Staphylococcus aureus subsp. aureus str. JKD6008      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|553594.3.peg.1250   Staphylococcus aureus A9765      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|93061.3.peg.863   Staphylococcus aureus subsp. aureus NCTC 8325      MQV−−−−−−−−−−−−−−−−−−−GVEPRHREISSSI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYNSVQVGVGRR         
fig|1158520.3.peg.316   Staphylococcus aureus M0280      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGEKSAYKNVQVGVGHR         
fig|553596.3.peg.2028   Staphylococcus aureus A9781      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGEKSAYKNVQVGVGHR         
fig|585152.3.peg.1858   Staphylococcus aureus subsp. aureus D139                            MVGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGLN−−−−−−−−−−−−−−−−−−−TKADEKSAYNNVQVGMGRR         
fig|585155.3.peg.2479   Staphylococcus aureus subsp. aureus H19      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWGVGLN−−−−−−−−−−−−−−−−−−−TKADEKSAYNNVQVGMGRR         
fig|585152.3.peg.699   Staphylococcus aureus subsp. aureus D139      CEL−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYDNVQVGAGQR         
fig|426430.8.peg.1178   Staphylococcus aureus subsp. aureus str. Newman      MCK−−−−−−−−−−−−−−−−−−−LAGPQHSEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSAYNNVQVG             
fig|93062.4.peg.1544   Staphylococcus aureus subsp. aureus COL      MCK−−−−−−−−−−−−−−−−−−−LAGPQHSEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSAYNNVQVG             
fig|585143.3.peg.2653   Staphylococcus aureus subsp. aureus 55/2053                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585147.3.peg.1653   Staphylococcus aureus subsp. aureus A017934/97                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585150.3.peg.2727   Staphylococcus aureus subsp. aureus C160                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585151.3.peg.1813   Staphylococcus aureus subsp. aureus C427                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585156.3.peg.1650   Staphylococcus aureus subsp. aureus M1015                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585157.3.peg.1765   Staphylococcus aureus subsp. aureus M809                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|585160.3.peg.1585   Staphylococcus aureus subsp. aureus WBG10049                            MTGPQHKEIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGRGPN−−−−−−−−−−−−−−−−−−−TKAGGKSAYINVQVGVGP          
fig|273036.3.peg.1774   Staphylococcus aureus RF122        I−−−−−−−−−−−−−−−−−−−LVGPQHREVGFPI−−−−−−−−−−−−−−−−−−−SADN−−−−−−−−−−−−−−−−−−−ASWRCPN−−−−−−−−−−−−−−−−−−−IEADFLSAYNNVQVGVGPS         
fig|273036.6.peg.1939   Staphylococcus aureus RF122        I−−−−−−−−−−−−−−−−−−−LVGPQHREVGFPI−−−−−−−−−−−−−−−−−−−SADN−−−−−−−−−−−−−−−−−−−ASWRCPN−−−−−−−−−−−−−−−−−−−IEADFLSAYNNVQVGVGPS         
fig|585152.3.peg.1872   Staphylococcus aureus subsp. aureus D139     MCKL−−−−−−−−−−−−−−−−−−−GWAPTKRISKGN−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IKADFLSAYNNVQVGVGPQ         
fig|585155.3.peg.2490   Staphylococcus aureus subsp. aureus H19     MCKL−−−−−−−−−−−−−−−−−−−GWAPTKRISKGN−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IKADFLSAYNNVQVGVGPQ         
fig|585152.3.peg.1856   Staphylococcus aureus subsp. aureus D139                            MAGPQQREIGTPI−−−−−−−−−−−−−−−−−−−SADN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−IEADEKSAYDNVQVGGAPT         
fig|585155.3.peg.2477   Staphylococcus aureus subsp. aureus H19                            MAGPQQREIGTPI−−−−−−−−−−−−−−−−−−−SADN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−IEADEKSAYDNVQVGGAPT         
fig|426430.8.peg.1169   Staphylococcus aureus subsp. aureus str. Newman                               GPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGATT         
fig|450394.6.peg.351   Staphylococcus aureus subsp. aureus USA300_TCH959                               GPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGATT         
fig|1158486.3.peg.649   Staphylococcus aureus M1320      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGAPT         
fig|1158512.3.peg.1080   Staphylococcus aureus M0154      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGAPT         
fig|553601.3.peg.2107   Staphylococcus aureus A10102      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGAPT         
fig|359786.3.peg.327   Staphylococcus aureus subsp. aureus JH9      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPNIEKLDHQFQQTMQVGVGPNTEAGEKSAYKNVQVGGAPT         
fig|553590.4.peg.2540   Staphylococcus aureus A9754      MRV−−−−−−−−−−−−−−−−−−−GVWGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|585152.3.peg.1575   Staphylococcus aureus subsp. aureus D139        M−−−−−−−−−−−−−−−−−−−GCVPQHREIGYPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRSPN−−−−−−−−−−−−−−−−−−−TEAVGKSAYKNEQVGGAPT         
fig|585155.3.peg.1804   Staphylococcus aureus subsp. aureus H19        M−−−−−−−−−−−−−−−−−−−GCVPQHREIGYPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRSPN−−−−−−−−−−−−−−−−−−−TEAVGKSAYKNEQVGGAPT         
fig|93061.3.peg.756   Staphylococcus aureus subsp. aureus NCTC 8325      CEL−−−−−−−−−−−−−−−−−−−GCGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|426430.8.peg.790   Staphylococcus aureus subsp. aureus str. Newman      CEL−−−−−−−−−−−−−−−−−−−GCGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|451515.3.peg.827   Staphylococcus aureus subsp. aureus USA300_FPR3757      CEL−−−−−−−−−−−−−−−−−−−GCGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|452948.4.peg.1928   Staphylococcus aureus 930918-3      CEL−−−−−−−−−−−−−−−−−−−GCGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|553594.3.peg.1071   Staphylococcus aureus A9765      CEL−−−−−−−−−−−−−−−−−−−GCGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADEKSAYNNVQVGGAPT         
fig|585151.3.peg.1577   Staphylococcus aureus subsp. aureus C427      CRL−−−−−−−−−−−−−−−−−−−GCRPQHREIGTPI−−−−−−−−−−−−−−−−−−−SIGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEADKKSAYDNVQVGGAPT         
fig|282459.5.peg.761   Staphylococcus aureus subsp. aureus MSSA476                               GPQHREFRKEILQAMRVGVWAPTQRISKRISTDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAYEKSAYDNVRVGVGQR         
fig|553601.3.peg.352   Staphylococcus aureus A10102        M−−−−−−−−−−−−−−−−−−−GCGPQHREFRKEILQAMRVGVWAPTKRISKRNSTGN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−TEAYDKSAYDNVQVGVVQR         
fig|93061.3.peg.2390   Staphylococcus aureus subsp. aureus NCTC 8325     MCKL−−−−−−−−−−−−−−−−−−−−AGPQHREFQKEIL−−−−−−−−−−−−−−−−−−QTMQ−−−−−−−−−−−−−−−−−−−VGERGPN−−−−−−−−−−−−−−−−−−−TEGDEKSAYNNVQVGGAPT         
fig|93062.4.peg.2322   Staphylococcus aureus subsp. aureus COL     MCKL−−−−−−−−−−−−−−−−−−−−AGPQHREFQKEIL−−−−−−−−−−−−−−−−−−QTMQ−−−−−−−−−−−−−−−−−−−VGERGPN−−−−−−−−−−−−−−−−−−−TEGDEKSAYNNVQVGGAPT         
fig|553583.3.peg.642   Staphylococcus aureus A9635      MQV−−−−−−−−−−−−−−−−−−−−SGAQHSKFGSSI−−−−−−−−−−−−−−−−−−−STDD−−−−−−−−−−−−−−−−−−−ASWRGSN−−−−−−−−−−−−−−−−−−−TETGGKSAFNNVQVGGAPT         
fig|282459.5.peg.1847   Staphylococcus aureus subsp. aureus MSSA476      CKLAELQHSGIGFPISTDIANWGNGPQHRKIGSSI−−−−−−−−−−−−−−−−−−−STNN−−−−−−−−−−−−−−−−−−−VSWGNSPN−−−−−−−−−−−−−−−−−−−TETGRKSASMNI                
fig|585155.3.peg.500   Staphylococcus aureus subsp. aureus H19                            MAGPQHREIGTAI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGENTAYNNVRVGRPPT         
fig|585155.3.peg.501   Staphylococcus aureus subsp. aureus H19                            MAGLQHREIGTAI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEAGEKSAYKNVQVGGAPT         
fig|553583.3.peg.482   Staphylococcus aureus A9635     MCKL−−−−−−−−−−−−−−−−−−−GCGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−AGWRGPN−−−−−−−−−−−−−−−−−−−IENFEKEILQVMQVGGAPT         
fig|585147.3.peg.1419   Staphylococcus aureus subsp. aureus A017934/97      CRL−−−−−−−−−−−−−−−−−−−GCRPQHREIGTPI−−−−−−−−−−−−−−−−−−−SIGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TENFKKEILQAMQVG             
fig|553596.3.peg.559   Staphylococcus aureus A9781       KL−−−−−−−−−−−−−−−−−−−GTGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−GSWRGPN−−−−−−−−−−−−−−−−−−−TEKLEP                       
fig|553601.3.peg.1757   Staphylococcus aureus A10102       KL−−−−−−−−−−−−−−−−−−−GTGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−GSWRGPN−−−−−−−−−−−−−−−−−−−TEKLEP                       
fig|450394.6.peg.878   Staphylococcus aureus subsp. aureus USA300_TCH959                            MAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−GSWRGPN−−−−−−−−−−−−−−−−−−−TEKLEPQFQQAMEVGDGAQ         
fig|553583.3.peg.1566   Staphylococcus aureus A9635                            MAGPQHREIGTQI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEPQFQQAMQVG             
fig|553583.3.peg.2215   Staphylococcus aureus A9635      CKL−−−−−−−−−−−−−−−−−−−−AGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEHQFQQAMQVGGAPT         
fig|553594.3.peg.1030   Staphylococcus aureus A9765                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGGAPT         
fig|585151.3.peg.2286   Staphylococcus aureus subsp. aureus C427      CEL−−−−−−−−−−−−−−−−−−−GCGSQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGGAPT         
fig|273036.6.peg.770   Staphylococcus aureus RF122        M−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRSPN−−−−−−−−−−−−−−−−−−−TEKLDSQFLQTMQVGGAPT         
fig|273036.3.peg.797   Staphylococcus aureus RF122      CKL−−−−−−−−−−−−−−−−−−−−AEPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−TEKLDSQFLQTMQVGGG           
fig|1158512.3.peg.667   Staphylococcus aureus M0154                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|426430.8.peg.750   Staphylococcus aureus subsp. aureus str. Newman                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|452948.4.peg.1494   Staphylococcus aureus 930918-3                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|546342.4.peg.777   Staphylococcus aureus subsp. aureus str. JKD6008                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|93062.4.peg.272   Staphylococcus aureus subsp. aureus COL                             AGPQHREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|553594.3.peg.1031   Staphylococcus aureus A9765                            MAGPQHREIGTPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|762962.3.peg.1254   Staphylococcus aureus subsp. aureus ATCC 51811                             AGPQHKEIGTPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|931460.3.peg.861   Staphylococcus aureus subsp. aureus CIGC93                             AGPQHKEIGTPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLERQFLQTMQVGVGP          
fig|93061.3.peg.1068   Staphylococcus aureus subsp. aureus NCTC 8325     MCKL−−−−−−−−−−−−−−−−−−−−AGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTNNASWRGPQHRSWRKVSLQKCASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEPQFLQTMQVGVGHR         
fig|93062.4.peg.1537   Staphylococcus aureus subsp. aureus COL     MCKL−−−−−−−−−−−−−−−−−−−−AGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTNNASWRGPQHRSWRKVSLQKCASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEPQFLQTMQVGVGHR         
fig|762962.3.peg.905   Staphylococcus aureus subsp. aureus ATCC 51811     MCKL−−−−−−−−−−−−−−−−−−−−AGPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTNN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−IEKLGHQFQQTMQVGVGHR         
fig|451515.3.peg.1158   Staphylococcus aureus subsp. aureus USA300_FPR3757                               GPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTNNASWRGPQYRSWRKVSLQKCASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEPQFLQTMQVGVGHR         
fig|553590.4.peg.206   Staphylococcus aureus A9754                               GPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTNNASWRGPQYRSWRKVSLQKCASWRGPN−−−−−−−−−−−−−−−−−−−IEKLEPQFLQTMQVGVGHR         
fig|546342.4.peg.1177   Staphylococcus aureus subsp. aureus str. JKD6008                               GPQQREIGSPI−−−−−−−−−−−−−−−−−−−PTDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−REKLEPQFLQTMQVGVGHR         
fig|546342.4.peg.2873   Staphylococcus aureus subsp. aureus str. JKD6008                            MAGPQQREIGFPN−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGRR         
fig|585147.3.peg.2303   Staphylococcus aureus subsp. aureus A017934/97                            MAGPQQREIGFPN−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGRR         
fig|585156.3.peg.2357   Staphylococcus aureus subsp. aureus M1015                            MAGPQQREIGFPN−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGRR         
fig|585157.3.peg.2410   Staphylococcus aureus subsp. aureus M809                            MAGPQQREIGFPN−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGRR         
fig|585150.3.peg.1570   Staphylococcus aureus subsp. aureus C160        M−−−−−−−−−−−−−−−−−−−GCGPQHREFQKEILQAMQVGVWAPTQKLTKSQLTIM−−−−−−−−−−−−−−−−−−−YKLRMGPN−−−−−−−−−−−−−−−−−−−TEKLDSQFLQTMQVSESPT         
fig|585160.3.peg.526   Staphylococcus aureus subsp. aureus WBG10049        M−−−−−−−−−−−−−−−−−−−GCGPQHREFQKEILQAMQVGVWAPTQKLTKSQLTIM−−−−−−−−−−−−−−−−−−−YKLGMGPN−−−−−−−−−−−−−−−−−−−TEKLDSQFLQTMQVSESPT         
fig|553583.3.peg.1082   Staphylococcus aureus A9635      CKL−−−−−−−−−−−−−−−−−−−GCGPQQREFRKEILQAMQVGVWGPTQKLTKSQLTIM−−−−−−−−−−−−−−−−−−−CKLGMGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGEAPT         
fig|450394.6.peg.2376   Staphylococcus aureus subsp. aureus USA300_TCH959     MCKL−−−−−−−−−−−−−−−−−−−GCGPQQREFQKRN−−−−−−−−−−−−−−−−−−−STGN−−−−−−−−−−−−−−−−−−−AGWRGPN−−−−−−−−−−−−−−−−−−−IEKLDLQFLQAMQVGV            
fig|452948.4.peg.2561   Staphylococcus aureus 930918-3     R−−−−−−−−−−−−−−−−−−−−−−−−−GPNTENFEKKF−−−−−−−−−−−−−−−−−−−YRQC−−−−−−−−−−−−−−−−−−−ELGRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGRR         
fig|273036.6.peg.1220   Staphylococcus aureus RF122     R−−−−−−−−−−−−−−−−−−−−−−−−−GPNTENFEKKF−−−−−−−−−−−−−−−−−−−YRQC−−−−−−−−−−−−−−−−−−−ELGRGPN−−−−−−−−−−−−−−−−−−−IEAGGKSAYNNVQVGVGRR         
fig|451515.3.peg.1992   Staphylococcus aureus subsp. aureus USA300_FPR3757        M−−−−−−−−−−−−−−−−−−−GCGPQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWGVGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVW           
fig|585152.3.peg.1859   Staphylococcus aureus subsp. aureus D139      MQV−−−−−−−−−−−−−−−−−−−GVGPQQREIGTPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWWGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQAMQVGVW           
fig|585147.3.peg.1857   Staphylococcus aureus subsp. aureus A017934/97      CEL−−−−−−−−−−−−−−−−−−−GCGSQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR         
fig|585150.3.peg.691   Staphylococcus aureus subsp. aureus C160      CEL−−−−−−−−−−−−−−−−−−−GCGSQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR         
fig|585160.3.peg.2115   Staphylococcus aureus subsp. aureus WBG10049      CEL−−−−−−−−−−−−−−−−−−−GCGSQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR         
fig|585143.3.peg.774   Staphylococcus aureus subsp. aureus 55/2053      CEL−−−−−−−−−−−−−−−−−−−GCESQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR         
fig|585157.3.peg.1974   Staphylococcus aureus subsp. aureus M809      CEL−−−−−−−−−−−−−−−−−−−GCESQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR         
fig|585156.3.peg.1858   Staphylococcus aureus subsp. aureus M1015      CEL−−−−−−−−−−−−−−−−−−−GCESQQREIGFPI−−−−−−−−−−−−−−−−−−−STDN−−−−−−−−−−−−−−−−−−−ASWRGPN−−−−−−−−−−−−−−−−−−−KEKLDSQFLQTMQVGVGQR