(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00015641

fig|526974.3.peg.604   Bacillus cereus BDRD-ST24                                                                                      KDVRFEFNPKHMAYNR−−VVDEAIRLVLGLL−−−−EN−−−−−−−−VEVTGIHIAC−−−−−−DYPVKIADLKIKDLSSKSECIYLDRDKKIETMYIGKRGSDNHLCIYNKKRENEENETL−−−−−−DQYPDVEHVTRFEARLRKKKAKEWIDSEYNPFDSI−−−−−IVGDLEKVDNSKIKVNDRIVLEAIMNDYH−−−−−−GRYFGMMDKDQKSNWRKKIKQHVP                              
fig|527026.3.peg.3247   Bacillus thuringiensis serovar sotto str. T04001                                                                                      KNVRFEFNPKHMAYNR−−VVDESIRLVLGLL−−−−EN−−−−−−−−VEVTGIHIAC−−−−−−DYPVKISNLKIKDLSSKSECIFLDRDKSLGTMYVGRRGSDNHLCIYDKKQENRENDTL−−−−−−DQYPDVEHVTRFEARLRKKKAREWIESDYNPFDSI−−−−−IVGDLVNLDDSEIKLGDRIILEAIMNDYH−−−−−−GRYFGMMDRFQRNTWRKKLNQ                                 
fig|553590.4.peg.2839   Staphylococcus aureus A9754                                                                                                                    M−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKKERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|451515.3.peg.8   Staphylococcus aureus subsp. aureus USA300_FPR3757                                   MSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIISYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKKERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|367830.3.peg.3   Staphylococcus aureus subsp. aureus USA300     SDPKLSFDAMTIVGNLNRDNAQALSK−−−FMSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIISYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKKERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|176280.10.peg.2433   Staphylococcus epidermidis ATCC 12228     SDPKLSFDAMTIVGNLNRDNAQALSK−−−FMSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIISYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|754026.3.peg.2313   Staphylococcus aureus subsp. aureus MRSA177     SDPKLSFDAMTIVGNLNRDNAQALSK−−−FMSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIISYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|1137133.3.peg.1916   Staphylococcus aureus subsp. aureus MRGR3                                   MSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIISYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|553573.3.peg.60   Staphylococcus aureus A8115                                   MSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRD−−−EMIWLKQNIIDYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADA−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFSDLHILQPDWKTIQ−−−−RTADRAIVFMLLSD−−−−−−−−EEEWGKLHRNSRTKYKNLIKEISPVD−−LTDLMKSTLKANEKQLQKQIDFWQHE
fig|176280.10.peg.2427   Staphylococcus epidermidis ATCC 12228     PEPKLSFDAMTIVGNLNKNNAHKLSE−−−FMSIEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADTWDRRNMRVEFNPNKLTHE−−−EMLWLKQNVIDYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMTDKSVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERRDNANI−−−−−−−−EVVSEHLWRVEIELKRGMVDYWN−−−−−−−DCFGDLHILQPDWKTIE−−−−RTSDRSMVFMLLND−−−−−−−−EEEWGKLERRTKNKYKQLIKEISPVD−−LTELMKLTLKANEKQLQKQIDFWL  
fig|904336.3.peg.849   Staphylococcus epidermidis VCU118                                                                                        MRVEFNPNKLTHE−−−EMLWLKQNIIDYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYTMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADV−−−−−−−−EVMFEHLWRVEIELKRDMVDYWN−−−−−−−DCFNDLHILKPSWSTLE−−−−NIKEQAMIYLLINA−−−−−−−−ESKWGQLTRPTKVKYKNMIKEISPID−−LTYLMKSTLKANEKQLQKQINFWQRE
fig|458233.11.peg.2111   Macrococcus caseolyticus JCSC5402     PEPKLHFDAMTIVGNLNKNNAHKLSE−−−FMSIAPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADAWDRRNMRVEFNPNKLTHE−−−EMLWLKQNIIDYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMTDKSVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADI−−−−−−−−EVMSEHLWRVEIELKRDMVDYWN−−−−−−−DCFNDLHILKPDWSSLE−−−−KVKDQAMIYMLIHE−−−−−−−−ESTWGKLERRTKNKYREMLKSISEID−−LTDLMKLTLKENEKQLQKQIEFWQRE
fig|979219.3.peg.140   Staphylococcus epidermidis NIHLM001     QNPKLSFDAMTIVGNLSRDNAQKLSS−−−FMSIEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADTWDRRNMRVEFNPNKLTHE−−−EMLWLKQNIINYM−−−−ED−−−−−−−−DGFTRIDLAF−−−−−−DFEDDLSNYYAMTDKAVKKTVFYGRDGKPETKYFGVRDSDRFIRIYNKKQERKDNADV−−−−−−−−EVMSDHLWRVEIELKRDMVDYWN−−−−−−−DCFNDLHILKPDWTSPE−−−−KLNEQAMVYMLIHE−−−−−−−−EDKWGELNKRTKYKYKNLIKEISPVD−−LTELMKSTLRENEKQLQKQIEFWQTK
fig|1169280.3.peg.2682   Enterococcus faecalis SF6375     SQPALSFDAMTIVGNLNKTNAKKLSD−−−FMSVEPQIRLWDILQTKFKA−−−−−−−−−−KALQEKVYIEYDKVKADTWDRRNMRVEFNPNKLTHE−−−EMIWLKQNIIDYM−−−−ED−−−−−−−−DGFTRLDLAF−−−−−−DFEDDLSDYYAMTDKAVKKTVFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADV−−−−−−−−EVVSEHLWRVEVELKRDMVDYWN−−−−−−−DCFNDLHILKPAWATLE−−−−KINEQAMVYTLLHE−−−−−−−−ESMWGKLSKNTKTKFKKLIREISPID−−LTELMKSTLKANEKQLQKQIDFWQRE
fig|458233.11.peg.78   Macrococcus caseolyticus JCSC5402     PLPKINFDRMTIIGDLPLDRVEHMAE−−−FLGNDPYVNLWEKMNNRFKG−−−−−−−−−−KALNEKVYIEHDRLKADAWNRRNFRIEFNPNNLSDD−−−EKLWIRENLSSVL−−−−EN−−−−−−−−VGFTRLDLAF−−−−−−DFEEDLSDFFVMSDNALKKTVFYGLDGKAETKYFGVRESDRFIRIYNKKQEQKDNADV−−−−−−−−EIELENYWRFEIELKRKRVDEWN−−−−−−SNCFNDMHILKPDWTTIE−−−−KLNERAIVCMLLTH−−−−−−−−ENEWGKLARHTKYKYRKMIKEISPID−−LTDLMRECLKKEESRLQKELDFWLYE
fig|272622.10.peg.759   Lactococcus lactis subsp. cremoris SK11         IKIDRLTIMGNIELGGNQVFQN−−−LCQFWDVIELQSNGEYAGFYGQLF−−−−−−RDSTENFYVSYMPIKAKRMKTKNFYLEFNPAKSGQD−−−NLNYVFDYLVPLL−−−−EE−−−−−−−−VSISRIDIAL−−−−−−DFERDLSSFILGGRS−−−KKKIFFGTDGKIETRYAGSGDEFIIRLYDKKKERTEKGDK−−−IAQEEVQKFDQLWRLEFELHGSGFIENQ−−LKKEFRFLSDTPIVQLDFEDRNYIELSPQEKIIFLSKDEH−−−−−−−−PELFAELSKATKAKYNALRKKASIID−−LADMTR−−−−−−−−−−−−−LPFELTE
fig|1111678.3.peg.619   Lactococcus lactis subsp. cremoris UC509.9         IKIDRLTIMGNIELGGNQVFQN−−−LCQFWDVIELQSNGEYAGFYGQLF−−−−−−RDSTENFYVSYMPIKAKRMKTKNFYLEFNPAKSGQD−−−NLNYVFDYLVPLL−−−−EE−−−−−−−−VSISRIDIAL−−−−−−DFERDLSSFILGGRS−−−KKKIFFGTDGKIETRYAGSGDEFIIRLYDKKKERTEKGDK−−−IAQEEVQKFDQLWRLEFELHGSGFIENQ−−LKKEFRFLSDTPIVQLDFEDRNYIELSPQEKIIFLSKDEH−−−−−−−−PELFAELSKATKAKYNALRKKASIID−−LADMTR−−−−−−−−−−−−−LPFELTE
fig|684738.3.peg.623   Lactococcus lactis subsp. lactis KF147         IKIDRLTIMANVELEENQTFQN−−−LCQYWEIMELQSNGEYAGYYGQLF−−−−−−PNSSENFYVSYTPLKAKKMKTKNFYLEFNPAKSSKA−−−NLKYVFDYLLPLL−−−−EE−−−−−−−−ISISRIDIAL−−−−−−DFERDLSSFILGGRS−−−KKKIYFGLDGKIETRYAGSGDEFIIRLYDKKKERIEKGDK−−−VVQDEVGKFDQLWRLEFELHGSGFIENQ−−LKKNFRFLSDTPISKLDYTDQNYIELSPQEKIIFLSKDEH−−−−−−−−PELFAELSKATKAKYNGLRKKASIVD−−LADMTR−−−−−−−−−−−−−LPFELTE
fig|488221.3.peg.1907   Streptococcus pneumoniae 70585                                                                 DEKENWYIEYTPVASIKMNKRPLKIEFTPSKVSKK−−−NFLIVFHRMFPYM−−−−FN−−−−−−−−IVISTFHLAY−−−−−−DFERDLSALRVNWPKVMYRPIY−−KGMKLETMDFGAPKGNYHLTAYNKLKERMDSGDM−−−AEIEIYQQYDNLWRIEYKFYNEGNIKKE−−LKNGLPFLAKIPVYIENFKGLEFNNLGVNEKIYLFALRNK−−−−−−−−PELFAESDKRTVAKYKKLAESISEVNL                           
fig|1131630.3.peg.1843   Streptococcus pneumoniae GA62331                                                                 DEKENWYIEYTPVASIKMNKRPLKIEFTPSKVSKK−−−NFLIVFHRMFPYM−−−−FN−−−−−−−−IAISTFHLAY−−−−−−DFERDLSALRVNWPKVMYRPIY−−KGMKLETMDFGAPKGNYHLTAYNKLKERMDSGDM−−−AEIEIYQQYDNLWRIEYKFYNEGNIKKE−−LKNGLPFLAKIPVYIENFKGLEFNNLGVNEKIYLFALRNK−−−−−−−−PELFAESDKRTVAKYKKLAESISEVNL                           
fig|760777.3.peg.1682   Streptococcus pneumoniae GA14688                                                                 DEKENWYIEYTPVASIKMNKRPLKIEFTPSKVSKK−−−NFLIVFHRMFPYM−−−−FN−−−−−−−−IAISTFHLAY−−−−−−DFERDLSALRVNWPKVMYRPIY−−KGMKLETMDFGAPKGNYHLTAYNKLKERMDSGDM−−−AEIEIYQQYDNLWRIEYKFYNEGNIKKE−−LKNGLPFLAKIPVYIENFKGLEFNNLGVNEKIYLFALRNK−−−−−−−−PELFAESDKRTVAKYKKLAESISEVNL                           
fig|1105275.3.peg.2051   Streptococcus agalactiae LMG 15089        KVSLDNITITAYIKSYKLLGLKR−−−LVEGHTAIIIQTAMTDMFRAYTK−−−−−−−DGGQVVLHMEYDKIKGQAFNARPFRLEFNPNKLRSV−−−DTEIIDTIIPYL−−−−ED−−−−−−−−ISISRADLAFDLF−−−−−EVDCSEFVLEKKGRPTATKEFRSDTGKLETKYLGASRSEKQVRLYNKKKEQLENGTD−−−KEKEFASQFKHWWRLEFQLRSRSVEEIFEVINTVV−−−−−−−−−−−−FKPFKFEGLPVETQIYLVALTRD−−−−−−−−KNLWKQLHRNTRAKYKKILETYQTSDIDYLGLLKDLLKHERLRLENQLAYY   
fig|1156939.3.peg.1816   Streptococcus agalactiae ZQ0910        KVSLDNITITAYIKSYKLLGLKR−−−LVEGHTAIIIQTAMTDMFRAYTK−−−−−−−DGGQVVLHMEYDKIKGQAFNARPFRLEFNPNKLRSV−−−DTEIIDTIIPYL−−−−ED−−−−−−−−ISISRADLAFDLF−−−−−EVDCSEFVLEKKGRPTATKEFRSDTGKLETKYLGASRSEKQVRLYNKKKEQLENGTD−−−KEKEFASQFKHWWRLEFQLRSRSVEEIFEVINTVV−−−−−−−−−−−−FKPFKFEGLPVETQIYLVALTRD−−−−−−−−KNLWKQLHRNTRAKYKKILETYQTSDIDYLGLLKDLLKHERLRLENQLAYY   
fig|211110.3.peg.224   Streptococcus agalactiae NEM316        KVSLDNITITAYIKSYKLLGLKR−−−LVEGHTAIIIQTAMTDMFRAYTK−−−−−−−DGGQVVLHMEYDKIKGQAFNARPFRLEFNPNKLRSV−−−DTEIIDTIIPYL−−−−ED−−−−−−−−ISISRADLAFDLF−−−−−EVDCSEFVLEKKGRPTATKEFRSDTGKLETKYLGASRSEKQVRLYNKKKEQLENGTD−−−KEKEFASQFKHWWRLEFQLRSRSVEEIFEVINTVV−−−−−−−−−−−−FKPFKFEGLPVETQIYLVALTRD−−−−−−−−KNLWKQLHRNTRAKYKKILETYQTSDIDYLGLLKD                   
fig|1154962.3.peg.215   Streptococcus agalactiae GB00959        KVSLDNITMTAYIKSKKYLAMKQ−−−LIETHLAITVQTAMTDMFRATTG−−−−−−−DGIHVVLHMNYDKQKGQDRKARPFRLEFNPNKLRLV−−−DSEIIDTIIPFL−−−−ED−−−−−−−−ISISRADLAFDLF−−−−−EVDCSEFVLEKKGRPTATKEFRSSTGTLETKYLGAPRSEKQVRLYNKKKEQLQNGTD−−−KDKDFASQFKHWWRLEFQLRSRSIDEIFEVIDTII−−−−−−−−−−−−FKPFNLKGLSIETQIYLTALIHD−−−−−−−−KNIWKKLHRNTRARYKKILETHQTSDTDYLGLLKDLLKHERPRLENQLAYY   
fig|1154881.3.peg.456   Streptococcus agalactiae MRI Z1-218        KVSLDNITMTAYIKSKKYLAMKQ−−−LIETHLAITVQTAMTDMFRATTG−−−−−−−DGIHVVLHMNYDKQKGQDRKARPFRLEFNPNKLRLV−−−DSEIIDTIIPFL−−−−ED−−−−−−−−ISISRADLAFDLF−−−−−EVDCSEFVLEKKGRPTATKEFRSSTGTLETKYLGAPRSEKQVRLYNKKKEQLQNGTD−−−KDKDFASQFKHWWRLEFQLRSRSIDEIFEVIDTII−−−−−−−−−−−−FKPFNLKGLSIETQIYLTALIHD−−−−−−−−KNIWKKLHRNTRARYKKILETHQTSDTDYLGLLKDLLKHERPRLENQLAYY   
fig|264199.4.peg.1937   Streptococcus thermophilus LMG 18311                                                                                        IRIDFNPNTLKEF−−−DGMKVWRQLMYFARLNSLT−−−−−−−−VRLSRFDLAFDIF−−−−−NRPEIVNLQHIKGGVTHKVFYGRGGELETKYWGSSGSNVQVRLYDKNKEIIAHKRE−−−−EKLDLGVNPFWWRLEFQLRTKAIGEDM−−VQDIMNRLDNFGFY−−−−−−−KLEHIRVDQRAFTIIFLSNPELLSLAFPNLKSDSIKKKKTRVRKLLREETN−−−QFAEELKEVLIQNLPKLNTELQLLVGE
fig|299768.6.peg.1940   Streptococcus thermophilus CNRZ1066                                                                                        IRIDFNPNTLKEF−−−DGMKVWRQLMYFARLNSLT−−−−−−−−VRLSRFDLAFDIF−−−−−NRPEIVNLQHIKGGVTHKVFYGRGGELETKYWGSSGSNVQVRLYDKNKEIIAHKRE−−−−EKLDLGVNPFWWRLEFQLRTKAIGEDM−−VQDIMNRLDNFGFY−−−−−−−KLEHIRVDQRAFTIIFLSNPELLSLAFPNLKSDSIKKKKTRVRKLLREETN−−−QFAEELKEVLIQNLPKLNTELQLLVGE
fig|469609.3.peg.1851   Streptococcus sp. 2_1_36FAA         VSIDRLTVIWDTDTGSLRRI−−−−−FKNLKQAISAKVDSFEINDNVRDDVFTLAKYFNEYDSINIIFFQLAIYGNEQLIRIDFNPNTLKEF−−−DGMQVWRQLMYFARLNSLT−−−−−−−−VRLSRFDLAFDIF−−−−−NKPEIVNLQHIKGGVTHKVFYGRGGELETKYWGSSGSNVQVRLYDKNKEIIAHKRE−−−−EKLDLAVNPFWWRLEFQLRTKAIGEEM−−VQDVMNRLDNFGFY−−−−−−−KLEHIRVEQRAFTIIFLNNPELLSLAFPNLKSDSIKKKKTRVRKLLREETN−−−QFAEELKEVLIQNLPKLNAELQLLVGE
fig|596322.3.peg.1492   Streptococcus salivarius SK126                                                                                        IRIDFNPNTLKEF−−−DGMKVWRQLMYFARLNSLT−−−−−−−−VRLSRFDLAFDIL−−−−−NRPEIVNLQHIKGGVTHKVFYGRGGELETKYWGSSGSNVQVRLYDKNKEIIAHKRE−−−−EKLDLAVNPFWWRLEFQLRTKAIGEEM−−VQDIMNRLDNFGFY−−−−−−−KLDHIRVEQRAFTIIFLNNPELLSLAFPNLKSDSIKKKKTRVRKLLREETN−−−QFAEELKEVLIQNLPKLNTELQLLVGE
fig|565639.4.peg.2783   Enterococcus faecalis T8         VCIDRITILVSSDNKYIKPI−−−−−FREFYHQIFAKLDHLFVSSIDTKNQFTISKTLEEDSYINLIFIEYVNIGNHDDIRIDFNPNTLKEF−−−EGMSVWRQIMAYIKLNRLD−−−−−−−−IRLSRIDIAFDIY−−−−−NRPEIATLTTTKGGIKQTIYLGRGGELETLYLGASGSNVQVRLYDKNKESISHKRY−−−−DKMDLEKSPFWWRLEFQLRTKAINEET−−VLELMKRLDTMGYY−−−−−−−DIRQFSLDDRIFITLFLYAPHQLKMVYSDMSDNAIAIRKSKLRAKLREQTN−−−EFSLELKQVLEDNLSNLGKELNKYSDE
fig|56780.15.peg.2280   Syntrophus aciditrophicus SB                                                               RFHLQFEAYNLFVGKAAKPGSTPNVYLSISAKTLWQE−−−GIDKALNWIGEDL−−−−ESIGKGIISFVKVSRVDLCADFWIPGGLSYDFLRAHKVSRN−−−KKRRLYLDEDEMESYYVASPNSHIKLRIYNKGLEVKKEGTKLWFLDFWKRESSDDIWRMEHEIHRPALKQFG−−−−−−INSLDDL                                                                                           
fig|525330.3.peg.1791   Lactobacillus johnsonii ATCC 33200         ISVDRITIIGVPKLNGDADTST−−−−−−FMRVIYRKWKKESFFKLTTSGNIINPDTDENIAYFEVPQ−−−−−−HQQGKIRVDYNPKRLREEPEAEWAKALRWLLDQL−−−−QD−−−−−−−−KRFSRLDIAFDMI−−−DLD−−−VKGYQPYIFGASRTIYMTRAWEVGSIYAGARGSRLQIRFYDKKLERKANH−−−−−−−−−EELDCDSYWRLEMQLRGSKTKTWYDDCKKKLDKF−−−−−YRIDPHGVT−−−−SLRDKITLLAIKQD−−−−−−−−EKILAELSKNSRVKFRKLMQQPDNQDRTVTLKLLNCLEESKQKIVDELESYLGE
fig|1134826.3.peg.307   Enterococcus faecium ERV69          SIDRITIVGKLKENIYYHTQNDVLILDFEQLMRVNEGNGYLKAVGNNGWQLLDQYEENIAYIEILK−−−−−−WQDGKGRIDFNPNKIGHF−−−LASSMKNFIHDLF−−−−LE−−−−−−−−PHFSRADIACDII−−−DVPDEFITQYRVVDP−−VSFKPIYGRSGKLETAYWGSRASERQIRLYNKKLEQETKRKI−−−−−−−VPPEIETWWRLELQLRRGKATDWHAMVHESLNSFASPHFLPLD−−−−−−−−VKTNDKVMIFGLIAN−−−−−−−−PEMWGFLERRMKYKLRDILKRESQNDELTNHLRETFSESADVLKKELDTWL  
fig|1134820.3.peg.617   Enterococcus faecium ERV102          SIDRITIVGKLKENIYYHTQNDVLILDFEQLMRLNENNGYVKSVGLNGWQIVDKHDENIAYIEILK−−−−−−YQEGQGRIDFNPNKISQF−−−LAGSMKNFIHDLF−−−−LE−−−−−−−−PHFSRADIACDII−−−DVPDDFITQYRVVDP−−VSFKPIYGRSGKLETAYWGSRASERQIRMYNKKLEQETKRKI−−−−−−−VPPEIKTWWRLELQLRRGKATDWYAMVHESLDSFASPHFLPTD−−−−−−−−TKHTDRIMIAGLISD−−−−−−−−QNLWAGLARHTKYKYRNLLKKESQSDELVNHLRETFSESADVLKKELDTWL  
fig|1138933.3.peg.3009   Enterococcus faecium E2560          SIDRITIVGNLKENIYYHTTHDVLILDFEQLMRLNEGNGYLRSVSNNGWQLLDQHEENIAYIEILK−−−−−−WQEGKGRIDFNPNKISQF−−−LASSMKNFIHDLF−−−−IE−−−−−−−−PHFSRADIACDII−−−DVPDEFITQYRVVDP−−VSFKPIYGRNGKLETAYWGSRSSERQIRMYNKKLEQEKKRKI−−−−−−−VPKEIVSWWRLELQLRRGKATDWHAMVYESLDSFASPHYLPAD−−−−−−−−TSVADKMMITALTTE−−−−−−−−HDYWGQINRKTKYKYRNLLKQESQNDELTNHLRETFAESADDLKKELDTWL  
fig|1134826.3.peg.383   Enterococcus faecium ERV69          SIDRITIVGKLNDTIAYWTKNGVVFVDFEQLMRLNENQGYLKSVGINGWQLFDQYGEDIAYIEILK−−−−−−FHEGKGRIDFNPNKIGQF−−−LASSMKGFIHDLF−−−−LD−−−−−−−−PHFSRADIACDIV−−−DVPDDFITQYRIVDP−−ISFKPIYGRSGKLETAYWGSRASERQVRLYNKKLEQERKKVI−−−−−−−VPKEIDTWWRLEMQLRRGKATDWHAMVQESLDSFASPHFLPID−−−−−−−−IKPIDKIVIDGLIAE−−−−−−−−PSNWSIIARHTKYKYRNLLKQESQNDELTNHLRETFKESADELKKELDTWL  
fig|535206.4.peg.1686   Enterococcus faecium E1162                                                                                                            MKGFIHDLF−−−−LD−−−−−−−−PHFSRADIACDIV−−−DVPDDFITQYRIVDP−−ISFKPIYGRSGKLETAYWGSRASERQVRLYNKKLEQERKKVI−−−−−−−VPKEIDTWWRLEMQLRRGKATDWHAMVQESLDSFASPHFLPID−−−−−−−−IKPIDKIVIDGLIAE−−−−−−−−PSNWSIIARHTKYKYRNLLKQESQNDELTNHLRETFKESADELKKELDTWL  
fig|1134820.3.peg.1054   Enterococcus faecium ERV102          SIDRITIVGKLNDTIAYWTQNGVVFVDFEQLMRLNENQGYLKSVGTNGWQLFDQYGEDIAYIEMLK−−−−−−FHPDKGRIDFNPNKIGEF−−−LKGSMKQFIHDLF−−−−LD−−−−−−−−AHFSRADIACDIL−−−GVPDDFITQYRIVDP−−VSFKPIYGRSGKLETAYWGSRASERQVRMYNKKLEQERKKQI−−−−−−−VPKEIETWWRIEMQLRRGKATDWHAMVRESLDSFASPHYLPGD−−−−−−−−VKPVDRIMIKGLNQD−−−−−−−−HSEWAYISRNLKYRLRKLLKEESQNDELTNHLRETFKESANDLKIELDTWL  
fig|1158545.3.peg.2831   Enterococcus faecium UAA1007          SIDRITIVGKLNDTIAYWTQNGVVFVDFEQLMRLNENQGYLKSVGTNGWQLFDQYGEDIAYIEMLK−−−−−−FHPDKGRIDFNPNKIGEF−−−LKGSMKQFIHDLF−−−−LD−−−−−−−−AHFSRADIACDIL−−−GVPDDFITQYRIVDP−−VSFKPIYGRSGKLETAYWGSRASERQVRMYNKKLEQERKKQI−−−−−−−VPKEIETWWRIEMQLRRGKATDWHAMVRESLDSFASPHYLPGD−−−−−−−−VKPVDRIMIKGLNQD−−−−−−−−HSEWAYISRNLKYRLRKLLKEESQNDELTNHLRETFKESANDLKIELDTWL  
fig|565665.3.peg.2632   Enterococcus faecium D344SRF          SIDRITIVGKLNDTIAYWTQNGVVFVDFEQLMRVNEGNGYLKAVGNNGWQLLDQYEENIAYIEILK−−−−−−WQDGKGRIDFNPNKIGEF−−−LKGSMKQFIHDLF−−−−LD−−−−−−−−AHFSRADIACDIL−−−GVPDDFITQYRIVDP−−VSFKPIYGRSGKLETAYWGSRASERQVRMYNKKLEQERKKQI−−−−−−−VPKEIETWWRIEMQLRRGKATDWHAMVRESLDSFASPHYLPGD−−−−−−−−VKPVDRIMIKGLNQD−−−−−−−−HSEWAYISRNLKYRLRKLLKEESQNDELTNHLRETFKESANDLKIELDTWL