(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00003470

fig|3702.11.peg.13599   Arabidopsis thaliana        KIE−−−KIGSEIS−−−−−−SLT−−LEEARILVDYLQDK−−−FGVS−−−−−−−−−PLSLAPAAA−−−−−−−−−−−−−−−−−−AVAAPADGGAAAV−−−−−−−−−−−−−VEE−−−QTEFDVVINEVPSS−−SRIAVIKAVR−−−−−ALTSLALKEAKELIEGLPKK−−−FKEGITKDEAEEAKKTLEEAGAKVSI 
fig|3702.7.peg.28487   Arabidopsis thaliana        KIE−−−KIGSEIS−−−−−−SLT−−LEEARILVDYLQDK−−−FGVS−−−−−−−−−PLSLAPAAA−−−−−−−−−−−−−−−−−−AVAAPADGGAAAV−−−−−−−−−−−−−VEE−−−QTEFDVVINEVPSS−−SRIAVIKAVR−−−−−ALTSLALKEAKELIEGLPKK−−−FKEGITKDEAEEAKKTLEEAGAKVSI 
fig|3702.11.peg.13603   Arabidopsis thaliana        KIE−−−KIGSEIS−−−−−−SLT−−LEEARILVDYLQDK−−−FGVS−−−−−−−−−PLSLAPAAA−−−−−−−−−−−−−−−−−−AVAAPADGGAAAV−−−−−−−−−−−−−VEE−−−QTEFDVVINEVPSS−−SRIAVIKAVR−−−−−ALTSLALKEAKELIEGLPKK−−−FKEGITKDEAEEAKKTLEEAGAKVSI 
fig|3702.7.peg.28491   Arabidopsis thaliana        KIE−−−KIGSEIS−−−−−−SLT−−LEEARILVDYLQDK−−−FGVS−−−−−−−−−PLSLAPAAA−−−−−−−−−−−−−−−−−−AVAAPADGGAAAV−−−−−−−−−−−−−VEE−−−QTEFDVVINEVPSS−−SRIAVIKAVR−−−−−ALTSLALKEAKELIEGLPKK−−−FKEGITKDEAEEAKKTLEEAGAKVSI 
fig|3702.11.peg.13602   Arabidopsis thaliana        KIK−−−KIGSEIS−−−−−−SLT−−LEESRILVDYVQDK−−−FGVS−−−−−−−−−ILFSAPAAA−−−−−−−−−−−−−−−−−−ALPPPLDNGGATAS−−−−−−−−−−−−−VER−−−QTTFDVVINDVPRG−−NRIAVITAIR−−−−−AMTSLSLSESKELIEGFPKK−−−FKEGVTKDEAEEDKTQLEEAGAKVSI 
fig|3702.7.peg.28490   Arabidopsis thaliana        KIK−−−KIGSEIS−−−−−−SLT−−LEESRILVDYVQDK−−−FGVS−−−−−−−−−ILFSAPAAA−−−−−−−−−−−−−−−−−−ALPPPLDNGGATAS−−−−−−−−−−−−−VER−−−QTTFDVVINDVPRG−−NRIAVITAIR−−−−−AMTSLSLSESKELIEGFPKK−−−FKEGVTKDEAEEDKTQLEEAGAKVSI 
fig|316274.7.peg.304   Herpetosiphon aurantiacus ATCC 23779       LSQG−−−KKLEAIKHVRLQTSLG−−LKEAKDYVEAIE−−−−−RGQS−−−−−−−−−−−PLSPVVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPPVLQLPEDLLREAQ−−−−IVAQQGN−−−−KIQAIKMVR−−−−−EATKLSLKEAKDLVES                                      
fig|316274.3.peg.304   Herpetosiphon aurantiacus ATCC 23779       LSQG−−−KKLEAIKHVRLQTSLG−−LKEAKDYVEAIE−−−−−RGQS−−−−−−−−−−−PLSPVVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPPVLQLPEDLLREAQ−−−−IVAQQGN−−−−KIQAIKMVR−−−−−EATKLSLKEAKDLVES                                      
fig|302409.3.peg.4   Ehrlichia ruminantium str. Gardel       IDID−−−SLVDQIC−−−−−−SLD−−LCRAAELVDKMEQK−−−LGFP−−−−−−−−−KGGLLTAV−−−−−−−−−−−−−−−−−−PATGGSQAE−−SA−−−−−−−−−−−−−VEE−−−KTEFSVIFDSYVAD−−KKIAVIKAVR−−−−−ECTSLGLKEAKEFVEKE−−−GAKELVEGKKYKKEEAEEIKKKLEDAGAKVTIK
fig|254945.3.peg.515   Ehrlichia ruminantium str. Welgevonden       IDID−−−SLVDQIC−−−−−−SLD−−LCRAAELVDKMEQK−−−LGFP−−−−−−−−−KGGLLTAV−−−−−−−−−−−−−−−−−−PATGGSQAE−−SA−−−−−−−−−−−−−VEE−−−KTEFSVIFDSYVAD−−KKIAVIKAVR−−−−−ECTSLGLKEAKEFVEKE−−−GAKELVEGKKYKKEEAEEIKKKLEDAGAKVTIK
fig|302409.5.peg.175   Ehrlichia ruminantium str. Gardel                                                                     AV−−−−−−−−−−−−−−−−−−PATGGSQAE−−SA−−−−−−−−−−−−−VEE−−−KTEFSVIFDSYVAD−−KKIAVIKAVR−−−−−ECTSLGLKEAKEFVEKE−−−GAKELVEGKKYKKEEAEEIKKKLEDAGAKVTIK
fig|269484.4.peg.253   Ehrlichia canis str. Jake      TVDID−−−SLVEQIC−−−−−−SLD−−LCKAAELVDKMEQK−−−LGFP−−−−−−−−−KGGLLTAV−−−−−−−−−−−−−−−−−−PAAGGGQAESSA−−−−−−−−−−−−−AEE−−−KTDFSVIFDSYAAD−−KKISVIKAVR−−−−−ECTNLGLKEAKEFVE                                       
fig|205920.11.peg.820   Ehrlichia chaffeensis str. Arkansas      TVDID−−−SLVEQIC−−−−−−SLD−−LCKAAELVEKMEQK−−−LGFP−−−−−−−−−KGGLLTAV−−−−−−−−−−−−−−−−−−PAAGGNQVEGGAA−−−−−−−−−−−−−AEE−−−KTDFSVVFESYAAD−−KKISVIKAVR−−−−−ECTSLGLKEAKEFVEKE−−−GAKELIEGKKYKKEEAEEIKKKLEDAGAKVSIK
fig|212042.5.peg.971   Anaplasma phagocytophilum HZ      SVDLD−−−DLVEKIC−−−−−−ALD−−LCSAAALVEKIEEK−−−LGFP−−−−−−−−−KGGLMASV−−−−−−−−−−−−−−−−−−SAAGSASQGAGGAA−−−−−−−−−−−−−EAE−−−KTEFIVMFDGYAAD−−KKIAVIKAVR−−−−−ECTSLGLKEAKDFVEQE−−−GSRELIEGKKYKKAEAEEVKKKLEDAGAQVSLK
fig|574556.4.peg.981   Anaplasma centrale str. Israel      SVDLD−−−SLVEQIC−−−−−−GLD−−LCSAAALVEKIEDK−−−LGFP−−−−−−−−−KGGLLTAM−−−−−−−−−−−−−−−−−−PAAGGAAQGAEDSG−−−−−−−−−−−−−GAE−−−QTEFVVMFDGYAPE−−KKIAVIKAVR−−−−−ECTTLGLKEAKDFVEQE−−−GSRELVEGKKYKKAEADEVKKKLEDAGATVSVK
fig|1000937.3.peg.478   Anaplasma marginale str. Washington Okanogan          D−−−SLAEQIC−−−−−−GLD−−LCSAAALVEKLEDK−−−LGFP−−−−−−−−−KGGLLTAM−−−−−−−−−−−−−−−−−−PAAGSAAQGAEDSG−−−−−−−−−−−−−GAE−−−QTEFVVMFDGYAPD−−KKISVIKAVR−−−−−ECTTLGLKEAKDFVEQE−−−GSRELVEGKKYKKAEAEEVKKKLEDAGATVSIK
fig|222891.5.peg.539   Neorickettsia sennetsu str. Miyayama              EIAQKIL−−−−−−SLS−−LVEAAELAAELKKV−−−LNLP−−−−−−−−−DVAMAPAAV−−−−−−−−−−−−−−−−−−AAAPATSESVEKKG−−−−−−−−−−−−−−−−E−−−ASKFTLILKSYGE−−KKTNAIKALKTIFKQELGQDMGLKELKDKVEAVPVD−−−VLSGLTKEKADAYAKILKEAECEPELK
fig|222891.8.peg.609   Neorickettsia sennetsu str. Miyayama              EIAQKIL−−−−−−SLS−−LVEAAELAAELKKV−−−LNLP−−−−−−−−−DVAMAPAAV−−−−−−−−−−−−−−−−−−AAAPATSESVEKKG−−−−−−−−−−−−−−−−E−−−ASKFTLILKSYGE−−KKTNAIKALKTIFKQELGQDMGLKELKDKVEAVPVD−−−VLSGLTKEKADAYAKILKEAECEPELK
fig|434131.3.peg.613   Neorickettsia risticii str. Illinois              EIAQKIL−−−−−−SLS−−LVEAAELAAELKKV−−−LNLP−−−−−−−−−DVAMAPAAV−−−−−−−−−−−−−−−−−−AAAPATSESVEKKG−−−−−−−−−−−−−−−−E−−−ASKFTLILKGYGE−−KKTNAIKALKTIFKQELGQDMGLKELKDKVEAVPVD−−−VLSGLTKEKADAYAKILKEAECEPELK
fig|292805.3.peg.644   Wolbachia endosymbiont strain TRS of Brugia malayi     MSNVTN−−−DLVDKIL−−−−−−SLN−−LLEASELVKVLEEK−−−IGLP−−−−−−−−−AGSFVDGAV−−−−−−−−−−−−−−−−−−SSSAPTSDNAASSV−−−−−−−−−−−−−AQE−−−KTECKVVIKEIDAS−−KKMEIIRTVR−−−−−KIDPTLGLKEAKELVESLPKD−−−LTASVPRGEAEKIKQQLIDAGATKVEL 
fig|569881.3.peg.192   Wolbachia endosymbiont of Culex quinquefasciatus JHB     MNNVTS−−−DLVDKIL−−−−−−SLN−−LLEASELVKVLEEK−−−IGLP−−−−−−−−−SGSFLGGAV−−−−−−−−−−−−−−−−−−GAGVPISDNANAPV−−−−−−−−−−−−−AQE−−−KAEYKVVIKEIDAS−−KKIGVIKAIR−−−−−EVNSTLNLKEAKELVESLPKD−−−LTANVSKDEAEKIKQKLIEAGAT     
fig|77038.4.peg.520   Wolbachia endosymbiont of Drosophila simulans     MSNVTS−−−DLVDKIL−−−−−−SLN−−LLEASELVKVLEEK−−−IGLP−−−−−−−−−AGSFLGGAV−−−−−−−−−−−−−−−−−−GAGAPIGDNAAAPA−−−−−−−−−−−−−AQE−−−KAEYKVVIKEIDAS−−KKIGVIKAVR−−−−−EVNSTLGLKEAKELVESLPKD−−−LTANVPKDEAEKIKQKLIEAGAT     
fig|313598.3.peg.959   Tenacibaculum sp. MED152             KDFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGGG−−−−−−−−−DDAADE−−−QTEFDVILTAAGA−−SKLAVVKLVK−−−−−ELTGLGLKDAKGIVDSAPAP−−−IKEGVSKDEAEGLKKSLEEAGAEVELK
fig|313594.3.peg.1504   Polaribacter irgensii 23-P             KDFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAAVV−−−−−−−−−−−−−−−−−−V−−GP−−−−AAGG−−−−−−−−−EEAAEE−−−QTEFDVILTAAGA−−SKLAVVKLVK−−−−−ELTGLGLKEAKGIVDSAPAA−−−VKEGVSKDEAAALKASLEEAGAEVELK
fig|391587.3.peg.4075   Kordia algicida OT-1             KEFAEQLV−−−−−−NLT−−VKEVNELADILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−−−GP−−−−AAPGD−−−−−−−−−ADAGDE−−−QTEFDVILKAAGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKGIVDSAPAP−−−IKEGVSKDEAEGLKASLEEAGAEVELK
fig|391603.3.peg.1948   Flavobacteriales bacterium ALC-1             KDFAEQLV−−−−−−NLS−−VKDVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGGG−−−−AAGG−−−−−−−−−−−−DAAEE−−−QTEFDVILKAAGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKGLVDDAPSA−−−IKEGVSKDEAEGLKSSLEEAGAEVELK
fig|50743.3.peg.2404   unidentified eubacterium SCB49             KDFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−AG−−−−GGAG−−−−−−−−−E−−AAEE−−−QSEFDVILTAAGG−−SKLAVVKLVK−−−−−ELTGAGLKDAKDLVDNAPSP−−−IKEGVSKDEAEALKAQLEEAGAEVELK
fig|216432.7.peg.8   Croceibacter atlanticus HTCC2559             KDFAEQLV−−−−−−NLT−−VKEVNELADILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−AG−−−−GGAD−−−−−−−−−AGGADE−−−QTEFDVILKGAGA−−SKLAVVKLVK−−−−−ELTGAGLKDAKELVDNAPSP−−−IKEGIAKDEAEALKAQLEEAGAEVELK
fig|398720.4.peg.834   Leeuwenhoekiella blandensis MED217             KDFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAM−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGG−−−−−−−−−DDAAEE−−−QTEFDVILKAAGG−−SKLAVVKLVK−−−−−ELTGAGLKDAKELVDNAPSP−−−IKEGIAKDEAEAIKSQLEEAGAEVELK
fig|156586.6.peg.1315   Flavobacteria bacterium BBFL7             KDFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAM−−−−−−−−−−−−−−−−−−A−−GP−−−−AGGG−−−−−−−−−DAAADE−−−QTEFDVILKAPGG−−AKLAVVKLVK−−−−−ELTGAGLKDAKDLVDNAPSP−−−IKEGVSKDEAEALKAQLEEAGAEVELK
fig|313595.4.peg.1704   Psychroflexus torquis ATCC 700755             KDFAEQLV−−−−−−NLT−−VKEVNELADILKDE−−−YGIE−−−−−−−−−PAAAPVVV−−−−−−−−−−−−−−−−−−−−−GG−−−−GAAG−−−−−−−−−−AEEVEE−−−QTEFDVILKAPGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKGLVDSAPAP−−−VKEAVSKDEAEALKAQLEEAGAEVELK
fig|411154.11.peg.2295   Gramella forsetii KT0803             KDFAEQLV−−−−−−NLT−−VKEVNELADILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GG−−−−GAAGG−−−−−−−−−EEAEE−−−QTEFDVILTAPGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKALVDEAPKP−−−VKEGVAKDEAEALKAQLEEAGAEVELK
fig|655815.4.peg.1126   Zunongwangia profunda SM-A87             KEFAEQLV−−−−−−NLT−−VKEVNELADILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GG−−−−AAAGG−−−−−−−−−EEAAEE−−−QTEFDVILKAPGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKELVDGAPKA−−−VKEGVSKDEAEALKSQLEEAGAEVELK
fig|313596.4.peg.2908   Robiginitalea biformata HTCC2501             KEFAEQLV−−−−−−NLT−−VKEVNELADILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GG−−−−AAAGG−−−−−−−DAGEAAEE−−−QTEFDVILKAAGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKDIVDSAPKA−−−VKEAVSKDEAEGIKKSLEEAGAEVELK
fig|313603.6.peg.12   Flavobacteriales bacterium HTCC2170             KDFAEQLV−−−−−−NLT−−VKEVNELADILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGGG−−−−AAEG−−−−−−−−−−GEAAEE−−−QSEFDVILTAAGG−−SKLAVVKLVK−−−−−ELTGLGLKDAKDIVDSAPKA−−−VKEGVSKDEAEGIKKSLEEAGAEVELK
fig|313590.3.peg.832   Cellulophaga sp. MED134             KEFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGG−−−−AGGG−−−−−−−−−−−−DAAEE−−−KSEFDVILKAAGA−−SKLAVVKLVK−−−−−ELTGLGLKDAKGLVDGAPSP−−−VKEGVAKDEAEALKAQLEEAGAEVELK
fig|487796.3.peg.1307   Flavobacteria bacterium MS024-2A             KEFAEQLV−−−−−−NLT−−VKEVNELANILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAAGG−−−−−−−−−DDAGEE−−−KTEFDVILKAAGA−−SKLAVVKLVK−−−−−ELTGLGLKEAKELVDSAPSP−−−LKEGIAKDEAEALVKSLEEAGAEVELK
fig|388413.5.peg.2131   Algoriphagus sp. PR1              QLADQLV−−−−−−NLT−−VKEVKELTDILKDQ−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGGA−−−−−−−DGGAAEEE−−−KTSFDVILKAAGA−−SKLAVVKLVK−−−−−ELTGLGLKDAKELVDSAPKA−−−LKEGIAKDEAEGLKKSLEEAGAEVEIK
fig|999421.3.peg.2290   Parabacteroides merdae CL09T00C40                 EQLV−−−−−−NLT−−VKEVSELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGGA−−−−−−−−−AAAAEE−−−KTSFDVVLKAAGA−−NKLAIVKLVK−−−−−ELTGLGLKEAKDMVDGAPSA−−−IKEGIAKADAEALKKQLEEAGAEVELK
fig|435591.13.peg.2250   Parabacteroides distasonis ATCC 8503                 EQLV−−−−−−NLT−−VKEVSELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGGA−−−−−−−−−AAAAEE−−−KTSFDVVLKAAGA−−NKLAIVKLVK−−−−−ELTGLGLKEAKDMVDSAPSA−−−IKEGIAKADAEAMKKQLEEAGAEVELK
fig|999417.3.peg.3224   Parabacteroides distasonis CL09T03C24                 EQLV−−−−−−NLT−−VKEVSELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AAGGA−−−−−−−−−AAAAEE−−−KTSFDVVLKAAGA−−NKLAIVKLVK−−−−−ELTGLGLKEAKDMVDSAPSA−−−IKEGIAKADAEALKKQLEEAGAEVELK
fig|1035193.3.peg.2427   Capnocytophaga sp. oral taxon 326 str. F0382                 EQLV−−−−−−NLT−−VKEVNELAQILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−A−−AG−−−−−−−GAGEAAAE−−−KTEFDVFLKSAGA−−NKLAVVKLVK−−−−−DLTGLGLKEAKEVVDGAPSK−−−VKEGVSKEEAEGLKKSLEEAGAEVELK
fig|1127691.3.peg.2027   Capnocytophaga sp. oral taxon 324 str. F0483                 EQLV−−−−−−NLT−−VKEVNELAQILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGG−−−−AVAG−−−−−−−GAAEAGAE−−−KTEFDVFLKSAGA−−NKLAVVKLVK−−−−−DLTGLGLKEAKEVVDGAPSK−−−VKEGVSKEEAEGLKKSLEEAGAEVELK
fig|553178.3.peg.746   Capnocytophaga gingivalis ATCC 33624                 EQLV−−−−−−NLT−−VKEVNELAQILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−TAGP−−−−A−−−−−−−−−−−AAGEAAAE−−−KTEFDVILKSAGD−−NKLAVVKLVK−−−−−DLTGLGLKEAKEVVDGAPSK−−−VKEGVSKADAENLKKSLEEAGAEVELK
fig|575590.3.peg.292   Bacteroidetes oral taxon 274 str. F0058                 EQLV−−−−−−NLT−−VKEVNELAEILKNE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−A−−AA−−−−−−−AGAPAAEE−−−KTSFDVMLKSAGA−−NKLAVVKLVK−−−−−ELTGLGLKEAKDIVDAAPSK−−−VKEGVSKEEAEELQKQLTGAGAEVELK
fig|402612.4.peg.1144   Flavobacterium psychrophilum JIP02/86             KQFAEQLV−−−−−−NLT−−VKEVNDLATILKDE−−−YGIE−−−−−−−−−PAAAAVVM−−−−−−−−−−−−−−−−−−QA−−−−−−−−−−GG−−−−−−−GEAAEEA−−−−−QTEFTVVLKEAGA−−SKLAVVKAVK−−−−−ELTGLGLKEAKDLVDAAPSN−−−VKEGVSKDEAEGLKKSLEEAGAVVELK
fig|391598.3.peg.1619   Flavobacteria bacterium BAL38             KQFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVVV−−−−−−−−−−−−−−−−−−AA−−−−−−−−−−GG−−−−−−−GDAGAAAE−−−QTEFTVVLKEAGA−−SKLGVVKAVK−−−−−ELTGLGLKEAKDLVDAAPTN−−−VKEGVSKDEAEGLKKALEEAGAVVELK
fig|1202532.3.peg.3131   Flavobacterium sp. F52             KQFAEQLV−−−−−−NLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVVV−−−−−−−−−−−−−−−−−−AA−−−−−−−−−−GG−−−−−−−GDGAAEEA−−−QTEFTVVLKDAGA−−SKLAVVKLVK−−−−−ELTGLGLKEAKDVVDGAPSN−−−VKEGVSKEEAEGLKKSLEEAGATVELK
fig|391596.3.peg.3148   Pedobacter sp. BAL39                 EQLV−−−−−−NLT−−VKEVNELAQILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AGDA−−−−−−−−−−APAAEE−−−KSTFDVILKEAGG−−QKLAVVKLVK−−−−−DLTGLGLKEAKDLVDGAPKE−−−LKAGVAKDEAEALKKQLEEAGAVVEIK
fig|525373.3.peg.3887   Sphingobacterium spiritivorum ATCC 33861             KQLAEQLV−−−−−−NLT−−VKEVKELADILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−AEGG−−−−−−−−−−AAAAEE−−−KTSFDVILKEAGG−−QKLAVVKLVK−−−−−DLAGLGLKEAKDLVDGAPKE−−−LKAGVSKDEAEALKKQLEEAGAVVEIK
fig|525372.3.peg.3985   Sphingobacterium spiritivorum ATCC 33300             KQLAEQLV−−−−−−NLT−−VKEVKELADILKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−AEGG−−−−−−−−−−AAAAEE−−−KTSFDVILKEAGG−−QKLAVVKLVK−−−−−DLAGLGLKEAKDLVDGAPKE−−−LKTGVSKDEAEALKKQLEEAGAVVEIK
fig|531844.3.peg.270   Flavobacteriaceae bacterium 3519-10                 ETLV−−−−−−NLT−−VKDVNELATILKDE−−−YGIE−−−−−−−−−PAAAAVVM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAG−−−−−−−GGAEAAEE−−−KTEFDVILKAAGG−−SKLAVVKLVK−−−−−DLTGAGLKEAKDMVDSAPAP−−−IKTGISKDEAEALKKQLEEAGAEVEVK
fig|525257.3.peg.1610   Chryseobacterium gleum ATCC 35910                 ETLV−−−−−−NLT−−VKDVNELAAILKDE−−−YGIE−−−−−−−−−PAAAAVVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGG−−−−−−−AAGEAAEE−−−KTEFDVILKSAGA−−SKLAIVKLVK−−−−−DLTGAGLKEAKDIVDGAPAP−−−IKTGVSKDEAEALKKQLEEAGAEVELK
fig|511995.9.peg.136   Azobacteroides pseudotrichonymphae genomovar. CFP2                 EQLV−−−−−−NLT−−IKEVSELTEILKTE−−−YGIE−−−−−−−−−LATSSSVA−−−−−−−−−−−−−−−−−−T−−GV−−−−STSVV−−−−−−−−−−−EVREE−−−KTSFDLILKGVGT−−NKLAIVKLVK−−−−−ELTGLGLKEAKGIVDNAPAP−−−LKEGITRNEAETLKKSLEEAGAEIDIR
fig|600809.5.peg.462   Blattabacterium sp. (Periplaneta americana) str. BPLAN          K−−−KLAEQLV−−−−−−NLT−−VQQVNELSNLLKNE−−−YGIE−−−−−−−−−−−PSDTLVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSSKKKEESSEKE−−−EKNIFNLILKSSGN−−SKLSVVKLVK−−−−−EITGKGLKESKELVDNVPNV−−−IKESIDKKEAEELKKKLEEIGAEVELK
fig|331104.5.peg.167   Blattabacterium sp. (Blattella germanica) str. Bge          E−−−KLAEQLV−−−−−−NLT−−VKQVNELALILKKK−−−YGIE−−−−−−−−−−−PSSLVKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENLSSQEEKISKKE−−−EKNIFNIILKSSGN−−SKLSVVKLVK−−−−−ETTGKGLKESKDLVDNIPSV−−−LKESVNKKEAEDLKNKFEEIGAEVELK
fig|269798.16.peg.3154   Cytophaga hutchinsonii ATCC 33406                 EQLV−−−−−−NLT−−VKEVNELASILKDE−−−YGIE−−−−−−−−−PAAAAVVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−SGGG−−−−−−−DAAAAVEE−−−KTAFDVILKSAGA−−SKLAVVKLVK−−−−−DLTGLGLKEAKDLVDGAPKP−−−VKEGASKDEAEAIKKQLEEAGAEVEIK
fig|504472.5.peg.4798   Spirosoma linguale DSM 74                 EQLV−−−−−−SLT−−VKEVNELATILKDE−−−YGIE−−−−−−−−−PAAAAPVM−−−−−−−−−−−−−−−−−−VAGG−−−−GAGAG−−−−−−−DAAPAVAE−−−KTSFDVVLKSAGA−−AKLAVVKLVK−−−−−DLTGLGLKEAKELVDTAPKP−−−VKEGVSKDEADALRKQLEEAGAEVEVK
fig|471854.5.peg.3556   Dyadobacter fermentans DSM 18053                 EQLV−−−−−−NLT−−VKEVNELAAILKDE−−−YGIE−−−−−−−−−PAAAGAVM−−−−−−−−−−−−−−−−−−VAGP−−−−AGGAG−−−−−−−ADAPAVEE−−−KTSFDVILKSAGA−−GKLAVVKLVK−−−−−DLTGLGLKEAKELVDGAPKP−−−VKEGVAKDEADALKKQLEEAGAEVEVK
fig|485918.6.peg.1699   Chitinophaga pinensis DSM 2588                 EQLV−−−−−−GLT−−VKEVQELADFLKSE−−−YGIE−−−−−−−−−PAAAAVVV−−−−−−−−−−−−−−−−−−S−−GD−−−−NGSGA−−−−−−−−−−−AAAEE−−−KTAFNVILKNAGA−−SKLNVVKIVK−−−−−DLTGLGLKEAKELVDGAPKS−−−LKEGVSKAEAEDLKAKLTEAGAEVEI 
fig|452471.5.peg.1624   Amoebophilus asiaticus 5a2                 EQLV−−−−−−NLT−−VKEVNELAAILKEE−−−HGIE−−−−−−−−−PAAAAPVV−−−−−−−−−−−−−−−−−−VAGGG−−−−AQGGD−−−−−−−−−SKAAEE−−−KTHFDVILKSAGA−−SKLSVVKLVK−−−−−DLTGLGLKEAKDLVDAAPKP−−−IKEGAPKAEAESLKSKLEEAGAEVELK
fig|313606.3.peg.3676   Microscilla marina ATCC 23134                                  EVNELVTILKDD−−−HGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−GP−−−−AGGGE−−−−−−−−−AGGGEEE−−−KTAFDVVLKSAGG−−AKLKVVKAVK−−−−−ELTGLGLKDAKALVDEAPKP−−−LKEGVDKAEADALKAQLEELGAEVEIK
fig|242619.1.peg.340   Porphyromonas gingivalis W83           DIKAIAEQLV−−−−−−NLT−−VKEVSELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−GAAGA−−−−−−−−−A−−AEEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EQCGLGLKEAKDLVDAAPST−−−VKEGVDKATAEALKKALEEAGAEVELK
fig|1030843.3.peg.1463   Porphyromonas gingivalis TDC60                            MT−−VKEVSELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−GAAGA−−−−−−−−−A−−AEEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EQCGLGLKEAKDLVDAAPST−−−VKEGVDKATAEALKKALEEAGAEVELK
fig|596327.3.peg.791   Porphyromonas uenonis 60-3           DIKAIAETLV−−−−−−NLT−−VKEVSELKELLKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AAGAA−−−−−−−−−A−−EAEE−−−KNSFDVVLKSFGS−−AKLAVVKAVK−−−−−EHAGLGLKEAKELVDAAPAN−−−IKEGVDKATAEALKAALEEAGAEVELK
fig|553175.3.peg.1708   Porphyromonas endodontalis ATCC 35406           DIKAIAETLV−−−−−−NLT−−VKEVSELANVLKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−GAAGA−−−−−−−−−A−−EAEE−−−KTSFDVVLKSFGS−−AKLQVVKAVK−−−−−EHCGLGLKEAKDIVDAAPAT−−−LKEGVDKATADAMKAALEEAGAEVELK
fig|742727.4.peg.5325   Bacteroides oleiciplenus YIT 12058                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGS−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|449673.7.peg.2436   Bacteroides stercoris ATCC 43183                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGS−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|693979.3.peg.1115   Bacteroides helcogenes P 36-108                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|226186.12.peg.2778   Bacteroides thetaiotaomicron VPI-5482                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGA−−−−−−−−−A−−AVEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|469587.3.peg.4154   Bacteroides sp. 2_1_16                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGA−−−−−−−−−A−−AAEE−−−KSSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|470145.6.peg.1233   Bacteroides coprocola DSM 17136                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPSV−−−VKEGLAKDEAESLKKVLEEAGAEVELK
fig|547042.5.peg.178   Bacteroides coprophilus DSM 18228                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−ESCGLGLKEAKDLVDGAPSV−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|1121094.3.peg.453   Bacteroides barnesiae DSM 18169                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|997886.3.peg.59   Bacteroides ovatus CL03T12C18                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|457394.3.peg.316   Bacteroides sp. 4_3_47FAA                 EQLV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGA−−−−−−−−−A−−AAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDMVDGAPST−−−VKEGLAKDEAESLKKTLEEAGAEVELK
fig|626522.3.peg.1824   Prevotella tannerae ATCC 51259           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGAA−−−−−−−−−A−−−AEE−−−KTAFDVILKAAGS−−AKLQVVKAVK−−−−−ENCGLGLKEAKDLVDGVPSK−−−LKEGVAKEEAESLKKVLEEAGAEVEI 
fig|626522.3.peg.2536   Prevotella tannerae ATCC 51259           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGAA−−−−−−−−−A−−−AEE−−−KTAFDVILKAAGS−−AKLQVVKAVK−−−−−ENCGLGLKEAKDLVDGVPSK−−−LKEGVAKEEAESLKKVLEEAGAEVEI 
fig|264731.4.peg.2079   Prevotella ruminicola 23           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAGA−−−−−−−−−ADAAEE−−−KTSFDVVLKSAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPAT−−−VKEGLSKEEAENLKKTIEAAGAEVELK
fig|563008.3.peg.729   Prevotella oris C735           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KSSFDVVLAEVGA−−TKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−IKEGVAKDEAENLKKVIEEAGAKVELK
fig|575611.3.peg.1759   Prevotella buccae D17               IAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KSSFDVVLAEVGA−−TKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−IKEGVAKDEAENLKKVIEEAGAKVELK
fig|537011.5.peg.1759   Prevotella copri DSM 18205           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KSTFDVVLAEVGG−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−IKEGVAKDEAENLKKAIEEAGAKVELK
fig|537011.5.peg.4909   Prevotella copri DSM 18205           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−A−−AAEE−−−KSTFDVVLAEVGG−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−IKEGVAKDEAENLKKAIEEAGAKVELK
fig|585502.3.peg.1363   Prevotella bergensis DSM 17361               IAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AAGGA−−−−−−−−−ADAAAEE−−−KSSFDVVLTDIGA−−TKLQVVKAVK−−−−−EACGLGLKEAKALVEGAPAA−−−IKEGLSKDEAENLKKAIEEAGAKVELK
fig|679189.3.peg.451   Prevotella timonensis CRIS 5C-B1           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAGGA−−−−−−−−−AGAAEE−−−KTSFDVVLTEVGA−−TKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPAT−−−IKEGLSKEEAENLKKAIEEAGAKIELK
fig|679190.3.peg.1754   Prevotella buccalis ATCC 35310           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−−AAGA−−−−−−−−−ADAAEE−−−KTSFDVVLTEVGA−−TKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPAT−−−IKEGLSKDEAENLKKAIEAAGAKAELK
fig|575614.3.peg.1448   Prevotella sp. oral taxon 299 str. F0039           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAG−−−−−−−−−−AAGGEE−−−KTSFDVVLTDAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGAPAT−−−IKEGLSKDEAENLKKAIEEAGAKVELK
fig|619693.3.peg.2470   Prevotella sp. oral taxon 472 str. F0295           DIKAIAEELV−−−−−−NLT−−VKEVNELANVLKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AAAGA−−−−−−−−−AAGAEE−−−KSSFDVVLVDAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGVPST−−−LKEGMSKDEAENLKKAIEEAGAKVELK
fig|575615.3.peg.1963   Prevotella sp. oral taxon 317 str. F0108                            MT−−VKEVNELANVLKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAAP−−−−GAGAA−−−−−−−−−AGGAEE−−−KSSFDVVLVEAGA−−AKLQVVKAVK−−−−−EACGLGLKEAKDLVDGVPST−−−LKEGMSKDEAENLKKAIEEAGAKVELK
fig|553171.3.peg.154   Prevotella bivia JCVIHMP010           DIKAIAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AAAGA−−−−−−−−−AAGAEE−−−KTSFDVVLADAGA−−NKLKVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−LKEGMSKDEAENLKKAIEAEGAKVELK
fig|553174.3.peg.1354   Prevotella melaninogenica ATCC 25845               IAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AAAAA−−−−−−−−−GGAAEE−−−KSDFDVVLVDAGA−−NKLKVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−LKEGMAKAEAENLKAAIEAEGAKVELK
fig|649761.3.peg.1845   Prevotella veroralis F0319               IAEELV−−−−−−NLT−−VKEVNELATVLKDE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−−AGP−−−−AAGGA−−−−−−−−−AGGAEE−−−KSEFDVVLVEAGA−−NKLKVVKAVK−−−−−EACGLGLKEAKDLVDGAPST−−−LKEGMAKAEAENLKKTIEAEGAKVELK
fig|445970.5.peg.2207   Alistipes putredinis DSM 17216           DVKKLAEELV−−−−−−NLT−−VKEVNELATILKEE−−−YGIE−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−A−−AP−−−−AAAAG−−−−−−−−−EAAAAE−−−KSAFDVILKNAGQ−−SKLQVIKVVK−−−−−DIAGLSLGDAKALVDAAPKA−−−IKEGVSKEEAESIKAQLEEAGAEVEVK
fig|146919.6.peg.1880   Salinibacter ruber        DIE−−−ELAEQLV−−−−−−GLT−−IQEANELANHLEEE−−−YDIQ−−−−−−−−−PASAGVAV−−−−−−−−−−−−−−−−−−AA−−−−−−−DGGGG−−−−−−−ADGDAEEEE−−−QTAFDVVLTGIGG−−NKIQVIKEVR−−−−−SITGMGLKEAKSLVDEAPNP−−−VSEGVSREEADDLKAQIEDAGGEVEL 
fig|518766.5.peg.2898   Rhodothermus marinus DSM 4252                 EQLV−−−−−−NLT−−IKEANELAKILEEE−−−YGIK−−−−−−−−−PAAAAVAV−−−−−−−−−−−−−−−−−−AAGP−−−−AGGD−−−−−−−−−GAAAAEE−−−KTEFDVILKAAGG−−NKIAVIKEVR−−−−−AITGLGLKEAKELVDSAPKP−−−IKEGVSKEEAEQIKAKLEEAGAEVEIK
fig|314254.3.peg.1630   Oceanicaulis alexandrii HTCC2633           DIAKLCEELL−−−−−−SLT−−ILEAKELNDLLEE−−−KGIK−−−−−−−−−PAAAAVA−−−−−−−−−−−−−−−−−−VAGP−−−−AAGGE−−−−−−−−−−AAAAEE−−−KDEFDVILVDAGD−−KKINVIKEVR−−−−−AITGLGLKEAKELVEAGGKA−−−VKEGAAKAEAEDIKKKLEDAGAKVELK
fig|394221.5.peg.1764   Maricaulis maris MCS10              KLCDELL−−−−−−ALT−−ILEAKELNDLLEE−−−KGIK−−−−−−−−−−−AAAAVA−−−−−−−−−−−−−−−−−−VAGP−−−−AGGGD−−−−−−−−−−APAAEE−−−KDEFDVVLTGAGD−−KKINVIKEVR−−−−−AITGLGLKEAKDLVEGAPKA−−−VKEAASKTEAEEIKAKLEAAGASVELK
fig|314260.3.peg.1924   Parvularcula bermudensis HTCC2503           DIKALAEQIV−−−−−−GLT−−LLEAKELQDLLKDE−−−YGIE−−−−−−−−−PATGGGVV−−−−−−−−−−−−−−−−−−MAGP−−−−VGGD−−−−−−−−GGGDAAEE−−−KTEFDVILTSAGD−−KKINVIKEVR−−−−−GITGLGLKEAKELVEGAPKP−−−VKEGVSKDEAEELKKKLEEAGAGVELK
fig|501479.3.peg.173   Citreicella sp. SE45                 EQIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AAG−−−−−−−−GEAAAEEE−−−KTEFDVILKSAGD−−KKINVIKEVR−−−−−GITGLGLKEAKELVEAGGKA−−−VKEGVSKDEAEAIKKQLEEAGAEVELK
fig|314265.3.peg.245   Roseovarius sp. HTCC2601                 EQIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AGG−−−−−−−−GEAAAEEE−−−KTEFDVILKSAGD−−KKINVIKEVR−−−−−GITGLGLKEAKELVEAGGKA−−−VKEGVSKDEAEEIKKKLEEAGAEIELK
fig|367336.3.peg.1286   Rhodobacterales bacterium HTCC2255           DIKKLAEEIV−−−−−−ALT−−LLEAQELKTLLKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−AGD−−−−−−−−−−TAAEEE−−−KDEFDVILKSAGD−−KKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGKA−−−VKEGVSKSEAEELKKQLEAAGAEVELK
fig|388399.4.peg.4353   Sagittula stellata E-37                 EQIV−−−−−−NLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AGD−−−−−−−−AGGAAEEE−−−KTEFDVILKSAGD−−KKINVIKEVR−−−−−GITGLGLKEAKELVEAGGKA−−−VKEGVSKDEAEELKKKLEEAGAEVEIK
fig|371731.3.peg.3172   Rhodobacter sp. SW2              KLAESIV−−−−−−GLT−−LLQAQELKTILKDK−−−YGIE−−−−−−−−−PAAGAAVA−−−−−−−−−−−−−−−−−−VAGP−−−−AAA−−−−−−−−−−AAAPVEEQ−−−−TEFDVVLTEAGP−−NKINVIKEVR−−−−−AITGLGLKEAKDLVEAGGK−−−−VKEGVSKADAEGFKKKLEEAGAKVELK
fig|349102.13.peg.2627   Rhodobacter sphaeroides ATCC 17025              KLAEDIV−−−−−−GLT−−LLEAQELKTILKDK−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAGP−−−−AA−−−−−−−−−−−AAAPAEEE−−−KTEFDVVLTDAGA−−NKINVIKEVR−−−−−AITGLGLKEAKDLVEAGGK−−−−VKEAASKADAEAMKKKLEEAGAKVELK
fig|557760.5.peg.1423   Rhodobacter sphaeroides KD131              KLAEDIV−−−−−−GLT−−LLEAQELKTILKDK−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AAG−−−−−−−−−−AAAPAEEE−−−KTEFDVVLTDAGA−−NKINVIKEVR−−−−−AITGLGLKEAKDLVEAGGK−−−−VKEAVAKADAEAMKKKLEEAGAKVELK
fig|272942.6.peg.293   Rhodobacter capsulatus SB1003                 EQIV−−−−−−NLT−−LLQAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAGP−−−−AAG−−−−−−−−−−PAEAAEEK−−−−TEFDVVLVDAGA−−NKINVIKEVR−−−−−AITGLGLKEAKDLVEAGGK−−−−VKEAAAKAEAEDIKKKLEAAGAKVELK
fig|318586.4.peg.698   Paracoccus denitrificans PD1222             KKLAEEIV−−−−−−GLT−−LLEAQELKNILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAGP−−−−AAG−−−−−−−−−−PAEAAEEK−−−−TEFDVVLVDAGA−−NKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−VKEGASKADAEEMKKKLEAAGAKVELK
fig|314232.3.peg.581   Loktanella vestfoldensis SKA53             KKLAEEIV−−−−−−GLT−−LLQAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−A−−−−−−−−−−−−ATAEAAEE−−−KTEFDVVLKDAGA−−QKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−VKEGASKAEADEIKAKLEAAGATVEL 
fig|314256.5.peg.1364   Oceanicola granulosus HTCC2516             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AGGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−QKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGIDKAEAEEIKSKLEAAGAEVEL 
fig|391613.3.peg.2929   Roseovarius sp. TM1035             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAIM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AGD−−−−−−−−AGGSDAEE−−−QTEFDVILKSAGA−−SKINVIKEVR−−−−−AITGLGLKEAKDLVDAGGKA−−−VKEQVSKDEADDIKAKLEAAGAEVEIK
fig|314264.3.peg.2802   Roseovarius sp. 217             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AGD−−−−−−−−AGGSDAEE−−−QTEFDVILKSAGA−−SKINVIKEVR−−−−−AITGLGLKEAKDLVDAGGKA−−−VKEQVSKDEADDIKAKLEAAGAEVEIK
fig|351016.3.peg.1089   Roseobacter sp. AzwK-3b             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−−−AGD−−−−−−−−AGAAAAEE−−−QTEFDVILKSAGA−−SKINVIKEVR−−−−−AITGLGLKEAKDLVEAGGKA−−−VKEQVSKDEAEEIKKKLEEAGAEVELK
fig|89187.3.peg.413   Roseovarius nubinhibens ISM             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAAA−−−−−−GGD−−−−−−−−AGGAAAEE−−−QTEFDVILKSAGA−−SKINVIKEVR−−−−−AITGLGLKEAKELVEAGGKA−−−VKEQVSKDEAEDIKGKLEAAGAEVELK
fig|314270.3.peg.52   Rhodobacterales bacterium HTCC2083             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−AGGAAAEE−−−QTEFDVILKAAGA−−SKINVIKEVR−−−−−AITGLGLKEAKELVEAGGKA−−−VKEGVSKEEAEDVKGKLEAAGAEVEVK
fig|388401.3.peg.541   Rhodobacterales bacterium HTCC2150             KKMAEEIV−−−−−−NLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−−AGESAEA−−−QTEFDVILVAAGA−−QKIGVIKEVR−−−−−AITGLGLKEAKDLVEAGGKA−−−VKEGVSQAEADEIKAKLEAAGAEVTLK
fig|398580.3.peg.266   Dinoroseobacter shibae DFL 12             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AGGD−−−−−−−−AGAAAEE−−−QTEFDVILKAAGA−−QKINVIKEVR−−−−−ALTGLGLKEAKELVEAGGKA−−−VKEGVDKAEAEEIKGKLEAAGAEVELK
fig|633131.3.peg.2972   Thalassiobium sp. R2A62             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAG−−−−−−−GGD−−−−−−−−AGGAAAEE−−−KTEFDVVLKNAGA−−QKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|314271.3.peg.1468   Rhodobacterales bacterium HTCC2654             KKLAEEIV−−−−−−GLT−−LLEAQELKEILKEE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AGGD−−−−−−−−−AGAAAEE−−−KTEFDVVLKSAGG−−NKIAVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|375451.6.peg.3735   Roseobacter denitrificans OCh 114             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−AGAAEEE−−−KTEFDVVLKSPGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGCDKAEAEEIKGKLEAAGAEVEL 
fig|391595.3.peg.1315   Roseobacter litoralis Och 149             KKMAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−AGAAEEE−−−KTEFDVVLKSPGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGCDKAEAEEIKGKLEAAGAEVEL 
fig|391626.6.peg.1640   Octadecabacter antarcticus 307             KKMAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−GGAAEEE−−−KTEFDVILKSPGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVSKEEAEDVKGKLEAAGAEVEL 
fig|391616.3.peg.2678   Octadecabacter antarcticus 238             KKMAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−GGAAEEE−−−QTEFDVILKSPGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVSKEEAEDVKGKLEAAGAEVEV 
fig|290400.10.peg.653   Jannaschia sp. CCS1             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−GAGGAAEE−−−QTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVDKAEAEEIKGKLEAAGAEVEL 
fig|314267.6.peg.947   Sulfitobacter sp. NAS-14.1             KKLAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−AGAAAEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGIDKAEAEDIKAKLEAAGAEIEL 
fig|391589.3.peg.3053   Roseobacter sp. GAI101             KKLAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−AGASAEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVDKAEAEEVKAKLEAAGAEVEL 
fig|391624.3.peg.1371   Oceanibulbus indolifex HEL-45             KKLAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAG−−−−−−−PAD−−−−−−−−−GGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVDKAEAEEIKGKLEAAGAEVEL 
fig|314262.5.peg.880   Roseobacter sp. MED193                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−M−−A−−−−−−−TGD−−−−−−−−AGGEAAEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVSKDEAEEVKGKLEAAGAEVEV 
fig|439496.3.peg.2496   Rhodobacterales bacterium Y4I                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−AGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVSKDEAEDIKGKLEAAGAEVEL 
fig|644107.3.peg.1248   Silicibacter lacuscaerulensis ITI-1157             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAA−−−−−−−GGD−−−−−−−AAGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEAVSKDEAEEIKGKLEAAGAEVEL 
fig|391593.3.peg.1608   Roseobacter sp. CCS2             KKMAEEIV−−−−−−ALT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAS−−−−−−−GGD−−−−−−−−AGGEAAAE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGASKDEAEEIKSKLEAAGAEVEL 
fig|252305.5.peg.44   Oceanicola batsensis HTCC2597             KKLAEEIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AGGGD−−−−−−−−AGAAEEE−−−KTEFDVILKSAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGKA−−−VKEGVSKDEAEEIKGKLEAAGAEIELK
fig|644076.3.peg.1867   Silicibacter sp. TrichCH4B                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−MAGP−−−−AGGE−−−−−−−−−−AAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|292414.10.peg.1095   Ruegeria sp. TM1040                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAA−−−−−−−GGD−−−−−−−AAGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|246200.3.peg.3770   Silicibacter pomeroyi DSS-3                 ESIV−−−−−−GLT−−LLEAQELKNILKDE−−−YGIE−−−−−−−−−PAAGGAVM−−−−−−−−−−−−−−−−−−VAA−−−−−AGGD−−−−−−−−AGAAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKDLVEAGGK−−−−IKEGVAKAEAEEIKAKLEAAGAEVEL 
fig|383629.4.peg.437   Phaeobacter gallaeciensis 2.10             KKLAEDIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|439497.5.peg.1464   Ruegeria sp. R11                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEDIKGKLEAAGAEVEL 
fig|467661.3.peg.2860   Rhodobacteraceae bacterium KLH11                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEEVKAKLEAAGAEVEL 
fig|388739.3.peg.337   Roseobacter sp. SK209-2-6                 ESIV−−−−−−GLT−−LLEAQELKTILKDE−−−YGIE−−−−−−−−−PAAGGAVV−−−−−−−−−−−−−−−−−−MAA−−−−−−−GGD−−−−−−−−AGGAAEEE−−−KTEFDVVLKNAGA−−SKINVIKEVR−−−−−GITGLGLKEAKELVEAGGK−−−−IKEGVDKAEAEDVKAKLEAAGAEVEL 
fig|59374.8.peg.1675   Fibrobacter succinogenes subsp. succinogenes S85     MATDIK−−−ALGDQIV−−−−−−GLT−−LLEAKALADYLKET−−−HGIE−−−−−−−−−AAAGGAV−−−−−−−−−−−−−−−−−−VMA−−−−−AAAAAP−−−−−−−−−−−−−AEE−−−KTEFDVILAEIDP−−AKKMAILKEVR−−−−−AITGLGLAEAKKVVETANSV−−−IKEAAPKADAEALKKKLEELGAKVTLK
fig|521674.6.peg.551   Planctomyces limnophilus DSM 3776              ELGDKIV−−−−−−ALT−−LLQAKALADYLEQV−−−HGIK−−−−−−−−−−−PAGGAV−−−−−−−−−−−−−−−−−−VMAPGGGGAAPAAP−−−−−−−−−−−−−VEE−−−KTEFDVILTGFGD−−−NKLSVIKVVR−−−−−TATGLGLKEAKDLVEGAPKP−−−VKTGISKEDADKLKKELEASGATAEIK
fig|344747.3.peg.3983   Planctomyces maris DSM 8797         TK−−−ELGDKIA−−−−−−GLT−−LLQAKDLAEYLDEV−−−HGIK−−−−−−−−−AAAGGAV−−−−−−−−−−−−−−−−−−MMAGPAAEAGPAA−−−−−−−−−−−−−−−EE−−−KTEFDVILTGFGD−−−NKIPVIKIVR−−−−−AATGLGLKEAKDLVEGAPKP−−−LKEGISKEDAEALVKEVKEAGGTAEVK
fig|314230.3.peg.4410   Blastopirellula marina DSM 3645                 DKIA−−−−−−TLT−−LKQAVELGDYLKDA−−−HGIE−−−−−−−−−AAAGGGVMM−−−−−−−−−−−−−−−−−−−−−−−−−−−AGPAA−−−−−−−−−−−GPAEEAAVQTEFDVVMTSFGG−−NKISVIKAIR−−−−−SITGLGLKEAKELTEGVPSK−−−VKEGVSKEDAEKVKAELTDAGAEVEIK
fig|530564.3.peg.2673   Pirellula staleyi DSM 6068          K−−−EIGDKIA−−−−−−GLT−−LKQAKELSDYIKEA−−−YGIE−−−−−−−−−PASGGGV−−−−−−−−−−−−−−−−−−MMAAPAAGGAAPAA−−−−−−−−−−−−−VEQ−−−−TEFDVILTAFGD−−−KKLDVVKVVK−−−−−NLTGLSLMDAKKLVEGVPGK−−−IKEQVSKADAEKVKAELVAAGATVELK
fig|243090.15.peg.6221   Rhodopirellula baltica SH 1      SAEAK−−−ELGDKIA−−−−−−NMT−−LKQAKELSDYLKDE−−−HGIE−−−−−−−−−PAAGGGAV−−−−−−−−−−−−−−−−−−MMAGPAGDGGGAAE−−−−−−−−−−−−−VEQ−−−−TEFDVVLTGFGE−−−KKLNVVKVVK−−−−−NITGASLMDAKKMVEGCPAT−−−LKEAVSKEDAEKVKAEIEEAGGSVELK
fig|243090.1.peg.7077   Pirellula sp. 1      SAEAK−−−ELGDKIA−−−−−−NMT−−LKQAKELSDYLKDE−−−HGIE−−−−−−−−−PAAGGGAV−−−−−−−−−−−−−−−−−−MMAGPAGDGGGAAE−−−−−−−−−−−−−VEQ−−−−TEFDVVLTGFGE−−−KKLNVVKVVK−−−−−NITGASLMDAKKMVEGCPAT−−−LKEAVSKEDAEKVKAEIEEAGGSVELK
fig|554065.3.peg.4447   Chlorella sp. NC64A                 EQIL−−−−−−QLN−−LLQVADLTEILKKK−−−LGIEAPPMMGMPMGMPMGG−−−−−−−−−−−−−−−−−−−−−−AAAAAPPAEAAAP−−−−−−−−−−−AAPVEE−−−KTEFTLKLEGYDAA−−AKIKVIKEVR−−−−−AITGLGLKEAKELVEAAPKV−−−VKEGLKKEEAEALQKTLLDAGAKVSL 
fig|3702.11.peg.26315   Arabidopsis thaliana               LVDEIS−−−−−−SLT−−LLEISELGSIIMKK−−−KGMTELPTVAVMKPGAGGGVGV−−−−−−−−−−−−−−−−−−GGGGGMVSQSGVSE−−−−−−−−−−−EAKVE−−−−KTVFEIKLESFEAS−−AKIKIIKELR−−−−−SFTDLGLKEAKALVEKTPAI−−−LKAGLSKEEGEKILEKLKALGAKVVL 
fig|3702.7.peg.24551   Arabidopsis thaliana               LVDEIS−−−−−−SLT−−LLEISELGSIIMKK−−−KGMTELPTVAVMKPGAGGGVGV−−−−−−−−−−−−−−−−−−GGGGGMVSQSGVSE−−−−−−−−−−−EAKVE−−−−KTVFEIKLESFEAS−−AKIKIIKELR−−−−−SFTDLGLKEAKALVEKTPAI−−−LKAGLSKEEGEKILEKLKALGAKVVL 
fig|3702.7.peg.24552   Arabidopsis thaliana               LVDEIS−−−−−−SLT−−LLEISELGSIIMKK−−−KGMTELPTVAVMKPGAGGGVGV−−−−−−−−−−−−−−−−−−GGGGGMVSQSGVSE−−−−−−−−−−−EAKVE−−−−KTVFEIKLESFEAS−−AKIKIIKELR−−−−−SFTDLGLKEAKALVEKTPAI−−−LKAGLSKEEGEKILEKLKALGAKVVL 
fig|3702.11.peg.16302   Arabidopsis thaliana                                                               GQSGG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GANE−−−−−−−−−−−GAKAE−−−−KTVFEVKLESFEAR−−AKIKIIKEVR−−−−−RIIGVGLKEAMKLVVKAPTV−−−LKTGLSKEEGEEVVEKLNALGAEAVL 
fig|3702.7.peg.6955   Arabidopsis thaliana                                                               GQSGG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GANE−−−−−−−−−−−GAKAE−−−−KTVFEVKLESFEAR−−AKIKIIKEVR−−−−−RIIGVGLKEAMKLVVKAPTV−−−LKTGLSKEEGEEVVEKLNALGAEAVL 
fig|3702.11.peg.10263   Arabidopsis thaliana              KIVNELS−−−−−−NLT−−LLETMDLTEILRQK−−−LNISELPVMAAMMPGMS−−−−L−−−−−−−−−−−−−−−−−−PGSGASKSAGGEGK−−−−−−−−−−−EKKKEA−−−KTAFDVMLQAYDAV−−SKIKVIKEVR−−−−−TITALGLKEAKDLVEKAPTL−−−LKKGVSKEEAEKIIEKLKAVGAKV   
fig|3702.7.peg.2674   Arabidopsis thaliana              KIVNELS−−−−−−NLT−−LLETMDLTEILRQK−−−LNISELPVMAAMMPGMS−−−−L−−−−−−−−−−−−−−−−−−PGSGASKSAGGEGK−−−−−−−−−−−EKKKEA−−−KTAFDVMLQAYDAV−−SKIKVIKEVR−−−−−TITALGLKEAKDLVEKAPTL−−−LKKGVSKEEAEKIIEKLKAVGAKV   
fig|186039.3.peg.3817   Fragilariopsis cylindrus CCMP 1102              ELANEIV−−−−−−HLN−−LLELKELTDKIAVH−−−FEFDDEMMAANYGGGGGG−−−−−−−−−−−−−−−−−−−−−−GAAGGDGAGAEVE−−−−−−−−−−−A−−VEE−−−KTIFDLKLIGFDAK−−AKIKVIKEVR−−−−−SIGGLGLKEAKELVEGAPKV−−−IQKDLKQDKAEELKAKLEAVGAQVEI 
fig|5786.3.peg.2   Dictyostelium purpureum QXDP1             KDIVERIS−−−−−−KLS−−LLQVTELTSLLQAK−−−LGVPDMDFSQMGGGGGAG−−GA−−−−−−−−−−−−−−−−−−PAAAAAPAAAA−−−−−−−−−−−−−−−−−−−−−−−KTEFSVKLIKVPDG−−AKYKIIKELR−−−−−EVKPSLSLMETKGLVEKTPSV−−−IADKVSKEEADKIVAKLKASGAELEV 
fig|9606.3.peg.14577   Homo sapiens (Human)           KIQQLVQDIA−−−−−−SLT−