(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020416

fig|1158485.3.peg.71   Staphylococcus aureus M1311     MLSIISMCHKFHFTDNIKFINLILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVGRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGIFYRLYAYVIHTLFM
fig|904727.3.peg.2083   Staphylococcus aureus subsp. aureus 21194     MLSIISMCHKFHFTDNIKFINLILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVGRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGIFYRLYAYVIHTLFM
fig|282458.1.peg.426   Staphylococcus aureus subsp. aureus MRSA252                            MLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVGRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|273036.3.peg.54   Staphylococcus aureus RF122                                MQIKHCIIEITIFCYFQFSTIYIYYTEGVGRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|931436.3.peg.470   Staphylococcus aureus subsp. aureus CIG1242     MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVGRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|1158486.3.peg.2640   Staphylococcus aureus M1320     MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|451515.3.peg.500   Staphylococcus aureus subsp. aureus USA300_FPR3757     MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|505321.3.peg.499   Staphylococcus aureus subsp. aureus str. CF-Marseille     MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNF                 
fig|93062.4.peg.952   Staphylococcus aureus subsp. aureus COL                            MLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM
fig|553567.3.peg.1970   Staphylococcus aureus A5948     MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYNTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM