(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020602

fig|282459.1.peg.68   Staphylococcus aureus subsp. aureus MSSA476     IPDPLSNPMSDPLLGDSWMVGDLK−−−−−−−−KRQEKKLITTVIAPEHDEKHRENKSKMKKSEKQLINQLINHGHTFKSDFKNVAKGDWVNKAMQDLDKLGNELKK
fig|1157018.3.peg.2125   Staphylococcus aureus M0239                       MVGDLK−−−−−−−−KRQEKKLITTVIAPEHDEKHRENKSKMKKSEKQLINQLINHGHTFKSDFKNVAKGDWVNKAMQDLDKLGNELKK
fig|1226740.3.peg.1746   Staphylococcus aureus subsp. aureus VH60                       MVGDLK−−−−−−−−KRQEKKLITTVIAPEHDEKHRENKSKMKKSEKQLINQLINHGHTFKSDFKNVAKGDWVNKAMQDLDKLGNELKK
fig|762962.3.peg.1733   Staphylococcus aureus subsp. aureus ATCC 51811                       MVGDLK−−−−−−−−KRQEKKLITTVIAPEHDEKHRENKSKMKKSEKQLINQLINHGHTFKSDFKNVAKGDWVNKAMQDLDKLGNELKK
fig|585151.3.peg.2807   Staphylococcus aureus subsp. aureus C427                       MVGDLK−−−−−−−−KRQEKKLITTVIAPEHDEKHRENKSKMKKSEKQLINQLINHGHTFKNDFKNVAKGDWVNKAMQDLDKLGNELKK
fig|525378.3.peg.1789   Staphylococcus epidermidis M23864:W1         MPNPIL−−−−−GDEVTDKLK−−−−−−−−KEMEKKKITGVIAPEHFKRHHDHENEMKAEEKALITQTMSHCHAFSKNFKGSAKGDWVDSAMSELDKISNNLKN
fig|176279.3.peg.2223   Staphylococcus epidermidis RP62A         MPNPIL−−−−−DDESIDKVK−−−−−−−−KEIEKKKITGVIAPEHFKKHHDHENEMKAEEKALITQTMKHCHAFSKNFKSSAKGDWVDSAISELDKISNNLKN
fig|904342.3.peg.2218   Staphylococcus epidermidis VCU126         MPNPIL−−−−−DDESIDKVK−−−−−−−−KEIEKKKITGVIAPEHFKKHHDHENEMKAEEKALITQTMKHCHAFSKNFKSSAKGDWVDSAISELDKISNNLKN
fig|553581.3.peg.2408   Staphylococcus aureus A9299                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKNFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|1169274.3.peg.2437   Staphylococcus aureus M1309                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKNFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|548474.3.peg.394   Staphylococcus aureus subsp. aureus TCH130                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKNFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|553596.3.peg.1732   Staphylococcus aureus A9781                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKNFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|1158485.3.peg.739   Staphylococcus aureus M1311                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|1226740.3.peg.729   Staphylococcus aureus subsp. aureus VH60                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|451515.3.peg.2588   Staphylococcus aureus subsp. aureus USA300_FPR3757                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|904781.3.peg.800   Staphylococcus aureus subsp. aureus IS-105                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|93062.19.peg.2427   Staphylococcus aureus subsp. aureus COL                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEK
fig|273036.6.peg.2487   Staphylococcus aureus RF122                           LE−−−−−−−−QMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEADFKNAAQGAWVKNATDELKDISNDLEK
fig|698737.3.peg.44   Staphylococcus lugdunensis HKU09-01          SNA−−−−−−−−IPDLAVMG−−−−−−−−GMMEKEQIRTVIAPEHDRMHHDHQNKLKSDEKILLDQMVSHFKKFEGEFKNAAQGDWVKSAMSELNDISDDLKH
fig|904745.3.peg.771   Staphylococcus aureus subsp. aureus 21262          PDI−−−−−−−−VPDIKSMI−−−−−−−−KNAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|585159.3.peg.559   Staphylococcus aureus subsp. aureus M899                                     MNAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|585147.3.peg.1945   Staphylococcus aureus subsp. aureus A017934/97     MTLIEPDMTL−−−−−RMPDISTTVETLNLISKMNAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|585151.3.peg.61   Staphylococcus aureus subsp. aureus C427     MTLIEPDMTL−−−−−RMPDISTTVETLNLISKMNAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|1157018.3.peg.2462   Staphylococcus aureus M0239     MTLIEPDMTL−−−−−RMPDISTTVETLNLISKMNAQKENIRSVVAPEHKHKYKDIENGLKGEEKVLIEQMAHHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|282459.1.peg.399   Staphylococcus aureus subsp. aureus MSSA476     MTLIEPDMTL−−−−−RMPDISTTVETLNLISKMNAQKENIRSVVAPEHKHKYKDIENGLKGEEKVLIEQMAHHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|762962.3.peg.1383   Staphylococcus aureus subsp. aureus ATCC 51811                                     MNAQKENIRSVVAPEHKHKYKDIENGLKGEEKVLIEQMAHHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|451515.3.peg.494   Staphylococcus aureus subsp. aureus USA300_FPR3757     MTLIEPDMTL−−−−−RMPDISTTVETLNLISKMEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|93062.19.peg.478   Staphylococcus aureus subsp. aureus COL                                     MEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|904781.3.peg.1992   Staphylococcus aureus subsp. aureus IS-105     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|548474.3.peg.1834   Staphylococcus aureus subsp. aureus TCH130     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQLAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|553596.3.peg.2355   Staphylococcus aureus A9781                                     MEAQKENIRSVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|1169274.3.peg.371   Staphylococcus aureus M1309     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRSVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|553581.3.peg.1265   Staphylococcus aureus A9299     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRSVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|1158485.3.peg.77   Staphylococcus aureus M1311     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRSVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK
fig|931454.3.peg.943   Staphylococcus aureus subsp. aureus CIG1524     MTLIEPDMNL−−−−−RMPDISTTVETLNLISKMEAQKENIRSVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKK