(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020327

fig|548474.3.peg.1677   Staphylococcus aureus subsp. aureus TCH130     LKVDDFVKNIKRPYLTVLGVFVVAYSLFFDSLMFFYGKLYDKLPVYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVKYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNKFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEEKFIYTSILINLASDA−−−−LLVRSYFNY
fig|450394.6.peg.2035   Staphylococcus aureus subsp. aureus USA300_TCH959     LKVDDFVKNIKRPYLTVLGVFVVAYSLFFDSLMFFYGKLYDKLPVYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVKYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNKFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEAKFIYTSILINLASDA−−−−LLVRSYFNY
fig|1158485.3.peg.231   Staphylococcus aureus M1311     LKVDDFVKNIKRPYLTVLGVFVVAYSLFFDSLMFFYGKLYDKLPVYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNEFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEEKFIYTSILINLASDA−−−−LLVRSYFNY
fig|904730.3.peg.47   Staphylococcus aureus subsp. aureus 21200     LKVDDFVKNIKRPYLTVLGVFVVAYSLFFDSLMFFYGKLYDKLPVYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNEFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEEKFIYTSILINLASDA−−−−LLVRSYFNY
fig|273036.6.peg.247   Staphylococcus aureus RF122                                                       MAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNEFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEEKFIYTSILINLASDA−−−−LLVRSYFNY
fig|273036.3.peg.467   Staphylococcus aureus RF122                                                                                           VRYLTLNVIVGYTLPLLLASIYVFGVAGFGFDVFNYWLGIVMMLFISW−−−−LGLFLFYKNEFD−−−SENPNKAVNVIAIIIKLFAFGGLFYISTI−−−−−VPNTADEEKFIYTSILINLASDA−−−−LLVRSYFNY
fig|1028799.3.peg.225   Staphylococcus aureus subsp. aureus VC40     LKVDDFVKNIKRPYLTVLGVFVVAVSLFFDAIMFFYAKLYDKLPMYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLFVSIYVFGVVGFGFDVFNYCLGIILMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFAFGGIFYISLI−−−−−VPVTQQEEIFIGLSIFINIIVDA−−−−LLVRSYFNY
fig|1158477.3.peg.2376   Staphylococcus aureus M1216     LKVDDFVKNIKRPYLTVLGVFVVAVSLFFDAIMFFYAKLYDKLPMYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLFVSIYVFGVVGFGFDVFNYCLGIILMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFAFGGIFYISLI−−−−−VPVTQQEEIFIGLSIFINIIVDA−−−−LLVRSYFNY
fig|451515.3.peg.337   Staphylococcus aureus subsp. aureus USA300_FPR3757     LKVDDFVKNIKRPYLTVLGVFVVAVSLFFDAIMFFYAKLYDKLPMYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLFVSIYVFGVVGFGFDVFNYCLGIILMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFAFGGIFYISLI−−−−−VPVTQQEEIFIGLSIFINIIVDA−−−−LLVRSYFNY
fig|553594.3.peg.2530   Staphylococcus aureus A9765     LKVDDFVKNIKRPYLTVLGVFVVAVSLFFDAIMFFYAKLYDKLPMYLLVFMAFTAVILIMMYIQE−−−−−−−KNE−−NYKVEKRYVVRYLTLNVIVGYTLPLLFVSIYVFGVVGFGFDVFNYCLGIILMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFAFGGIFYISLI−−−−−VPVTQQEEIFIGLSIFINIIVDA−−−−LLVRSYFNY
fig|1157018.3.peg.2309   Staphylococcus aureus M0239     MNLKEIVGNIKRPYLTPMVIFSIIFTLFFSSFMYFAGNIQGKLPIYLDVFLIFGVVISILMYIQE−−−−−−−KSE−−TVKVSKRNVLIYLTLNVLTGYTLVLLIASVYVFGATVNGFDVFNYWLGIILMLFVSW−−−−FALFLFYKNEFD−−−SENPNKAVNVIAIIIKLSAFGGLFYIRTV−−−−−VPNTADEEKFITLSILINIAVDA−−−−LLVRSYFNY
fig|585143.3.peg.555   Staphylococcus aureus subsp. aureus 55/2053                                     MYFYGNLQGKLPIYLDVFLIFAAVVFILMYFQE−−−−−−−KSG−−EVKVEKSNVIRYLTLNVVAGYSMVLLVASIYVFGVAGYGFDVFNYWLGIILMLFVSW−−−−FALFLFYKNEFD−−−SENPNKAVNVIAIIIKLSAFGGLFYIRTV−−−−−VPNTADEEKFITLSILINIAVDL−−−−LLVRSYFNY
fig|585150.3.peg.378   Staphylococcus aureus subsp. aureus C160     MKIQEIVGNIKRAYLTPLIIFVILFSLFFDLIMYFYGNLQGKLPIYLDVFLIFAAVVFILMYFQE−−−−−−−KSG−−EVKVEKSNVIRYLTLNVVAGYSMVLLVASIYVFGVAGYGFDVFNYWLGIILMLFVSW−−−−FALFLFYKNEFD−−−SENPNKTVNVIAIIIKLSAFGGLFYIRTV−−−−−VPNTADEEKFITLSILINIAVDL−−−−LLVRSYFNY
fig|585157.3.peg.2698   Staphylococcus aureus subsp. aureus M809     MKIQEIVGNIKRAYLTPLIIFVILFSLFFDLIMYFYGNLQGKLPIYLDVFLIFAAVVFILMYFQE−−−−−−−KSG−−EVKVEKSNVIRYLTLNVVAGYSMVLLVASIYVFGVAGYGFDVFNYWLGIILMLFVSW−−−−FALFLFYKNEFD−−−SENPNKAVNVIAIIIKLSAFGGLFYIRTV−−−−−VPNTADEEKFITLSILINIAVDL−−−−LLVRSYFNY
fig|450394.6.peg.2036   Staphylococcus aureus subsp. aureus USA300_TCH959     MEIKEIVANIKRPYLTPFVIFTILLSLFFDAIMFFNSKLYDKLPLYLVVFLIFAIVVSILLYLQE−−−−−−−KSE−−KVKVEKKNVILYMTLNVITGYSMPLFIASTYVVGAAVNDIDVFYYWCGVALMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFALATIFYISKV−−−−−APSIADEKNFIFVSILINLGVDA−−−−LLVRSYFNY
fig|548474.3.peg.1678   Staphylococcus aureus subsp. aureus TCH130     MEIKEIVANIKRPYLTPFVIFTILLSLFFDAIMFFNSKLYDKLPLYLVVFLIFAIVVSILLYLQE−−−−−−−KSE−−KVKVEKKNVILYMTLNVITGYSMPLFIASTYVVGAAVNDIDVFYYWCGVALMLFISW−−−−LGLFLFYKNEFD−−−SENPNPAVNAIAIIIKLFALATIFYISKV−−−−−APSIADEKNFIFVSILINLGVDA−−−−LLVRSYFNY
fig|698737.3.peg.1894   Staphylococcus lugdunensis HKU09-01     ITKEEIAHNIKNPYITPVAILMNILALVLYSIMFFPQHLLYKLPKYIYIFLLFWLIINVISYVQE−−−−−−−KSK−−KVKTDKGTLIRYIIISTLCGYSLSISCSSVYVFGATTNGYDVFDYWLIIIIANVISL−−−−IGFNIFVISEFGLIQSLSGSAGNIMGIAITLGGFGILIYLSRI−−−−−VPYTDNENNFIWMSIIVILMINL−−−−LIGRSYFN 
fig|525378.3.peg.1295   Staphylococcus epidermidis M23864:W1       LKQAVRNIKNAYLTPFGIAINGLTILFYGILLSLNNTYQRLPIYIIIFIVLWLIINIISILQE−−−−−−−RNK−−SINLSKKHVLTYMIVNVLCGYSLIIAFISIYFIGATVNEFNVFNYWLYLLIILLVSW−−−−IGFHLFCISYFKVIDLSINKLIQVIGIILIILSIISLIYFAFI−−−−−VPITDGENMFIVGGIIALLCVYG−−−−LLTRSYYNY
fig|525376.3.peg.325   Staphylococcus epidermidis W23144        KKSIESIQHSYLIGLSLVNFIIFGFYYFIYSGPGIRGNMPLYMKIYLIVSLLLWLILYLQEREY−−IFKNY−−NRKNYKFRVATYMSINLLSGYNIPFLISSAYAFYFADSRDDTFTYWLLICGLIIVSA−−−−IGLFLFCLGEFEMFGIQNGSFIRMIGILTILLSFGLLLYVSLI−−−−−LPVVSEENQTIWMGMIMLFCSHL−−−−LIGRTYF  
fig|525376.3.peg.1743   Staphylococcus epidermidis W23144      KLEESLKKLRKPSVQVMNVLSLLMILAGVVQYFYSLTIERTPFYLIITTLIEIIIIFFGFIQL−−−−−FEKKDNIELKTARR−−−−YLIIGCLTGYSTYLSFYNSYFFMAEEHHIHLTTFWVVGFLFLLICASAHICKLLLMADKLPWLK−−−−−−−−GNKYVWIMVLSVIASTIYVQKIVEYILIPNVAESHFVIIVSMLMIFVANS−−−−LATQYFLLY
fig|629742.3.peg.1453   Staphylococcus hominis SK119       MEESLNRLRKPAIQVVNIFSLLFIFFSYIQYQFDLTLERTPNYLIITTGFALVINLLGLFQF−−−−−FEKKIDNPINKAKR−−−−YLIVNILSLYVSYLTFYNLYFFVAAEHQYYLDKYWYIGFITLLVCTTMHILSVLLMRFSPKWLK−−−−−−−−YDKRIVIIILKAIASLIYIQKIIEYITIPNIADSYFVFLISILYIFACNF−−−−LVTIYYILY
fig|698737.3.peg.1892   Staphylococcus lugdunensis HKU09-01       MEETYQALRKPATQAMNMLALGSILFSSIQYFVGLTLAATANYLIIATSIELLIIFCGLLQL−−−−−FFPKIPSDRKKIKKRALIFMIVGILSTYSSYLSFYNIYFFIEGNTQEIRIYWILGTVIAIICFSAHILSLIFMTITPSFIK−−−−−−−−−DKTLLILFLKFVAILLYVQKAIEFFIIPDHQGNRFLMIGLLLLIPLMNY−−−−ICTYFYLLF
fig|883164.3.peg.947   Staphylococcus lugdunensis ACS-027-V-Sch2       MEETYQALRKPATQAMNMLALGSILFSSIQYFVGLTLAATANYLIIATSIELLIIFCGLLQL−−−−−FFPKIPSDRKKIKKRALIFMIVGILSTYSSYLSFYNIYFFIEGNTQEIRIYWILGTVIAIICFSAHILSLIFMTITPSFIK−−−−−−−−−DKTLLILFLKFVAILLYVQKAIEFFIIPDHQGNRFLMIGLLLLIPLMNY−−−−ICTYFYLLF
fig|396513.4.peg.131   Staphylococcus carnosus subsp. carnosus TM300      TEENIYENLRKPGTQAISLITLFFVLFTGLIFAFGLKLENAPNYLLASTAFQIIIALIGFIPL−−−−−LYKTKPNNYGKFVKRLTGFSALCIISVYNLTFTVYNIYFYLAAQHGVYLFKFWIIGTLTMIICYGFQLMQQFTLLREPEKFKGESENDKFLRKMIFLFMFKVLSYIVFIQKIIEYFTIPNIAESRFTIIVVGVLIYAAMVFCSNVLYQSVLAY
fig|525378.3.peg.1303   Staphylococcus epidermidis M23864:W1     MSTAEFLDDIRKPGAQVLSIFLFLILSYASLVFLFGANIEDMYLGLRIFLIVQIIIIIISVIQFKDFFKYENID−−NKFKVKKYAKFLTTVNILSTYNAIFMFHNIFYVLALQSKYNLENFWLVTTSIILLFCILDLISNMFILIDVPFIEKFIDNK−−LIAKLGIIFKALAQLIFVEKIIEYFMLPYYLDNKFTIIASILIILSANV−−−−VAFLYMKKY
fig|525376.3.peg.2084   Staphylococcus epidermidis W23144     MKLNSAIDELRKPATQVVSLFALFMILFSGIAFFYGLDYDRLPDYLKIITLIEVVIIFISLLQFFRFVNFDKSKNVNKKTLKKYAKLLTIINIIGTYNAAFAFSNVFYVMAIQNFVDLYHYWLLSTVSMIISFTFWTLGSILMFIEMPKLEQYINGK−−RKTFIGIGFVLLAQLLYVERIIEYFLVPNIADSKFMILGSILVLLGIYL−−−−VTFEWIRKY
fig|1028799.3.peg.241   Staphylococcus aureus subsp. aureus VC40     MTTKENIDTLRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIIISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITAVFATCNLYYFVAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILVPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|450394.6.peg.2050   Staphylococcus aureus subsp. aureus USA300_TCH959     MTTKENIDILRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|548474.3.peg.2590   Staphylococcus aureus subsp. aureus TCH130     MTTKENIDILRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|273036.3.peg.479   Staphylococcus aureus RF122     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITVVFALYNLYYFAAVQNHYDLFNYWLMGMISIIISYLLLVIGGMFTLLKLPKVTKRWAGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|273036.6.peg.265   Staphylococcus aureus RF122     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITVVFALYNLYYFAAVQNHYDLFNYWLMGMISIIISYLLLVIGGMFTLLKLPKVTKRWAGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|1158477.3.peg.2391   Staphylococcus aureus M1216     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−ARKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|1158486.3.peg.2505   Staphylococcus aureus M1320     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−ARKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|548475.3.peg.2121   Staphylococcus aureus subsp. aureus TCH70     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−TQKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYILK                                          
fig|931441.3.peg.510   Staphylococcus aureus subsp. aureus CIG1835     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−TQKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILIPNVVESKFIIIVSMMVIAGAQF−−−−VAFQFIMQY
fig|451515.3.peg.352   Staphylococcus aureus subsp. aureus USA300_FPR3757     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGSISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSSFIYIEKIIEYILVPNVVESKFIIIVSMLVIAGAQF−−−−VAFQFIMQY
fig|553594.3.peg.1271   Staphylococcus aureus A9765     MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITVVFALCNLYYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYILVPNVVESKFVIMVSIIIIACTQF−−−−VAFQFIMQY
fig|450394.6.peg.2057   Staphylococcus aureus subsp. aureus USA300_TCH959     MTTKENIDILRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITAVFATCNLYYFVAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYILVPNVVESKFVIMVSIIIIACTQF−−−−VAFQFIMQY
fig|548474.3.peg.2592   Staphylococcus aureus subsp. aureus TCH130     MTTKENIDILRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIVISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITAVFATCNLYYFVAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYILVPNVVESKFVIMVSIIIIACTQF−−−−VAFQFIMQY
fig|451515.3.peg.360   Staphylococcus aureus subsp. aureus USA300_FPR3757     MTTKENIDILRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIIISLLQWIRFIDFEKES−−AQKYKKIYARFLVIINVLTTITAVFATCNLYYFVAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYILVPNVVESKFVIMVSIIIIACTQF−−−−VAFQFIMQY
fig|1158485.3.peg.216   Staphylococcus aureus M1311     MTTKENIDILRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIIISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITAVFATCNLYYFVALQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYMLVPNVVESKFVIMVSIIIIVCTQF−−−−VAFQFIMQY
fig|904730.3.peg.1120   Staphylococcus aureus subsp. aureus 21200     MTTKENIDILRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIIISLLQWIRFIDFEKES−−AQKYKKIYARFLVVINVLTTITAVFATCNLYYFVALQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGK−−TKTHFGLLLTALSAFIYIERIIEYMLVPNVVESKFVIMVSIIIIVCTQF−−−−VAFQFIMQY