(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020544

fig|367830.3.peg.1621   Staphylococcus aureus subsp. aureus USA300     VSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
fig|451515.3.peg.2687   Staphylococcus aureus subsp. aureus USA300_FPR3757     MSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
fig|282459.5.peg.2562   Staphylococcus aureus subsp. aureus MSSA476     MSETDEPQGFERTHNILNINQNRQSLMTFIISKLKSTLKQRIINARGKKRIDYRLSYNFYITYYDTVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
fig|450394.6.peg.1575   Staphylococcus aureus subsp. aureus USA300_TCH959     MSETDEPQGFERTHNILNINQNRQSLMTFIISKLKSTLKQHIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
fig|273036.3.peg.2376   Staphylococcus aureus RF122     VSETDEPQGFEHTHNILNINQNSKSLMTFITSKLKSKLKQRIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHMMSFDNTHFFAQLRHPVL
fig|273036.6.peg.2575   Staphylococcus aureus RF122     MSETDEPQGFEHTHNILNINQNSKSLMTFITSKLKSKLKQRIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHMMSFDNTHFFAQLRHPVL
fig|585155.3.peg.124   Staphylococcus aureus subsp. aureus H19     MSETDEPQGFEHTHNILNINQNSQSLMTFITSKLKSKLKHHIIIARGKKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMPIAILIRHMMSFDNAHFFAQLRHPVL
fig|1158485.3.peg.655   Staphylococcus aureus M1311     MSETDEPQGFEHTHNILNINQNSQSLMTFIISKLKSKLKHHIIIARGNKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMAIAILIRHTMSFDNAHFFAQLRHPVL
fig|1213730.3.peg.638   Staphylococcus aureus M0877     MSETDEPQGFEHTHNILNINQNSQSLMTFIISKLKSKLKHHIIIARGNKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMAIAILIRHTMSFDNAHFFAQLRHPVL
fig|1006543.3.peg.2553   Staphylococcus aureus subsp. aureus T0131     MSETDEPQGFEHTHNRLNINQNSQSLMTFITSKLKSKLKQHIIIARGNKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMAIAILIRHTMSFDNAHFFAQLRHPVL
fig|546343.3.peg.1741   Staphylococcus aureus subsp. aureus str. JKD6009     MSETDEPQGSEHTHNRLNINQNSQSLMTFITSKLKSKLKQHIIIARGNKRIDYRLSYNFYTTYYDNVEIKKIDCEYTYAMAIAILIRHTMSFDNAHFFAQLRHPVL