(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00005564

fig|1209359.3.peg.1050   Staphylococcus sp. MDS7B     KARSFIQTMYSELKYN−−−TNEIENRMKEIEQEINLTGSYTHTYEELSYGAKMAWRNSNRCIGRLFWNSLNVKDAR−−−−−−−DVCDEKEFIKFIHTHIKEATNGGKIKPYITIFSPE−−−−−DTPKIYNNQLIRYAGYEN−−−−−VGDPSEKKVTRLAEHLGWKG−−KGSNFDILPLIYQLPNDTIKIHELPNDIVKEVSIHHEH−−−−YPKLSKLGLKWYAVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDTYRYNLLEKVAEAFEFDTLKNNSFNKDRALVELNHAVYHSFKADGVSIVDHLTAAKQFEMFERNEHQQNRNVTGKWSWLAPPLSPTLTSNYHHGY−−DNTMHHTNFFYKKEE
fig|1155133.3.peg.2051   Staphylococcus epidermidis NIH05003     KARSFIQTMYSELKYN−−−TNEVENRMKEIEQEINLTGSYTHTYEELSYGAKMAWRNSNRCIGRLFWGSLNVKDAR−−−−−−−DVCDEKEFIKFIHTHIKEATNGGKIKPYITIFSPE−−−−−DTPKIYNNQLIRYAGYEN−−−−−VGDPSEKKVTRLAEHLGWKG−−KGSNFDILPLIYQLPNDTIKIHELPSDIVKEVSIHHEH−−−−YPKLSKLGLKWYAVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDTYRYNLLEKVAEAFEFDTLKNNSFNKDRALVELNHAVYHSFKADGVSIVDHLTAAKQFEMFERNEHQQNRDVTGKWSWLAPPLSPTLTSNYHHGY−−DNTMHHTNFFYKKEE
fig|525376.3.peg.1951   Staphylococcus epidermidis W23144     KAKSFIQTMYSELKYN−−−ANEIENRMKEIEQEINLTGSYTHTYEELSYGAKMAWRNSNRCIGRLFWDSLNVKDAR−−−−−−−DVCDEKEFIKFIHTHIKEATNGGKIKPYITIFSPE−−−−−DTPKIYNNQLIRYAGYEN−−−−−AGDPSEKEVTRLAEHLGWKG−−KGSNFDILPLIYQLPNDTIKIHELPHDIVKEVSIHHEN−−−−YPKLSKLGLKWYAVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDTYRYNLLEKVAEAFEFDTLKNNSFNKDRALVELNHAVYHSFKADGVSIVDHLTAAKQFEMFERNEHQQNRDVTGKWSWLAPPLSPTLTSNYHHGY−−DNTMHHTNFFYKKEE
fig|904334.3.peg.708   Staphylococcus epidermidis VCU116     EAKSFIQTMFNELNYS−−−SSETQQRLNEIEEEIKETGSYTHTYEELVYGSKMAWRNSNRCIGRLFWESLNVEDAR−−−−−−−HVENEEEFIDTIHQHINKATNNGKIKPLITIYSPK−−−−−NGPKIYNNQLIRYAGYDK−−−−−AGDPSEKKVTRLAQHLGWSS−−EGTDFDILPLIYQMPNEALKFHEYPKHLIKEVPIFHDQ−−−−YPKLAHLNLKWYAVPIISNMDLKIGGIIYPTAPFNGWYMVTEIGVRNFIDSYRYNLLEKVAEAFEFDTLKNNSFNKDRALLELNYAVYHSFKAEGVSIVDHLTASKQFEMFERNELKHDRHVTGKWSWLAPPLSPTLTSNYHHGY−−DNTMRSTNFYYKKNE
fig|525378.3.peg.2305   Staphylococcus epidermidis M23864:W1     EARSFIQTMYTELNYD−−−SSKIAERLNEIENEITRTGSYTHTYEELSYGAKLAWRNSNRCIGRLFWDSLNVEDAR−−−−−−−DIDNEENFLEAIYRHIDIATNGGKIKPLITIFSPQ−−−−−NAPKIYNNQLIRYAGYDN−−−−−AGDPSEKEITRLAQHLGWKG−−EGTNFDILPLIYQISNGSIKWHEFPNHIIKEVPIWHDQ−−−−YPKLAELGLKWYAVPIISNMDLKIGGITYPTAPFNGWYMVTEIGVRNFTDSYRYNLLEKVAEAFDFGTLKNNSFNRDRALVELNYAVYHSFKSEGVSIVDHLTASKQFEMFERNEQKNDRPVTGKWSWLAPPLSPTLTSNYHHGY−−DNTMRSTNFFYKKDE
fig|629742.3.peg.2161   Staphylococcus hominis SK119     EATNFIQTMYGELNYP−−−NHTISKRITEIGKEINRTGTYTHTYEELNYGAKMAWRNSNRCVGRLFWESLNVVDAR−−−−−−−DIYTEQHFLDALHNHLNKATNGGKIKPYITIFSST−−−−−DAPKIYNNQLIRYAGYED−−−−−KGDPSEREITQLANHLGWKG−−KGSDFDVLPLIYQLPNSPIKYHEFPASLIKEVDIEHDQ−−−−FPKLKDLHLKWYGVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDTYRYNLLEKVAETFEFGTLKNNSFNKDRTLVELNYAVYHSFKSQGVSIVDHLTAAKQFELFEEKEEQHHRDVTGKWSWLAPPLSPTLTANYHHGY−−KNIIKDPNFHYKKAT
fig|279808.3.peg.1752   Staphylococcus haemolyticus JCSC1435     EARSFIEMMYRELNYN−−−PSIFDKRIKEIEKEIEHTGTYTHTLEELSYGAKLAWRNSNRCIGRLFWDSLNVEDAR−−−−−−−NVDNERDFIDTINHHLEHATNNGKIKPYITIFSPN−−−−−QAPRIYNNQLIRYAGYEH−−−−−AGDPSEREITQLAEHLGWKG−−KGTDFDVLPLIYQLPNDSIKWYELPNELIKEVEIEHEH−−−−YPKLKDLNLKWYGVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDSYRYNLLESIAEAFEFGTLKNNSFNKDRTLVELNYAVYHSFKSQGVSIVDHLTASKQFQLFEEKELANNRDVTGKWSWLAPPLSPTLTSNYHHGY−−NNEIKDPNFHYKKK 
fig|279808.8.peg.1024   Staphylococcus haemolyticus JCSC1435     EARSFIEMMYRELNYN−−−PSIFDKRIKEIEKEIEHTGTYTHTLEELSYGAKLAWRNSNRCIGRLFWDSLNVEDAR−−−−−−−NVDNERDFIDTINHHLEHATNNGKIKPYITIFSPN−−−−−QAPRIYNNQLIRYAGYEH−−−−−AGDPSEREITQLAEHLGWKG−−KGTDFDVLPLIYQLPNDSIKWYELPNELIKEVEIEHEH−−−−YPKLKDLNLKWYGVPIISNMDLKIGGITYPTAPFNGWYMVTEIAVRNFTDSYRYNLLESIAEAFEFGTLKNNSFNKDRTLVELNYAVYHSFKSQGVSIVDHLTASKQFQLFEEKELANNRDVTGKWSWLAPPLSPTLTSNYHHGY−−NNEIKDPNFHYKKK 
fig|1158534.3.peg.2490   Staphylococcus aureus M0513     EAQAFIENMYKECHYE−−−TQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−DVTDEASFLSSINYHIAQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKYYEYPTSLIKEVPIEHDH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKKK 
fig|1213730.3.peg.1262   Staphylococcus aureus M0877     EAQAFIENMYKECHYE−−−TQIINKRLHDIELAIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−NVTDEASFLSSITYHITQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHDH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKKQE
fig|553571.3.peg.383   Staphylococcus aureus A6300     EAQAFIENMYKECHYE−−−TQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−DVTDEASFLSSITYHITQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVANAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKKKE
fig|451515.3.peg.2020   Staphylococcus aureus subsp. aureus USA300_FPR3757     EAQAFIENMYKECHYE−−−TQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−DVTDEASFLSSITYHITQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKKKE
fig|553594.3.peg.1614   Staphylococcus aureus A9765                                                         MAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−DVTDEASFLSSITYHITQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKKKE
fig|273036.3.peg.1793   Staphylococcus aureus RF122     EAQAFIENMYKECHYE−−−TQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDAR−−−−−−−DVTDEASFLSSITYHITQATNEGKLKPYITIYAPK−−−−−DGPKIFNNQLIRYAGYDN−−−−−CGDPAEKEVTRLANHLGWKG−−KGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNH−−−−YPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLENVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGY−−DNTVKDPNFFYKNKE
fig|596319.3.peg.2160   Staphylococcus warneri L37603     KATTFIQTMYSELNYT−−−QDEIDNRIKEINHEILKTGTYTHTLEELTYGAKMAWRHSNRCIGRFFWESLNVKDAR−−−−−−−DINDETHFLEAIEDHIIKGTNDGKIKPYITIFSPD−−−−−EPPKIYNNQLIRYAGYEN−−−−−CGDPSERDVTTLAQHLGWQG−−NGGDFDVLPLIYQINDGPIKYYEYPKSIIKEVIIEHDR−−−−YPKLKDLNLKWYAVPIISNMDLQIGGITYPTAPFNGWYMVTEIAVRNFTDSYRYDLLEKVAEAFEFDTLKNNSFNKDRALIELNYAVYHSFKSQGVSIVDHLTASKQFEMFEMNEAKHQREVTGKWSWLAPPISPTLTNNYHHGY−−DNTMRDPNFFYKQ  
fig|1034809.4.peg.1039   Staphylococcus lugdunensis N920143     KAIQFIQTMYKELKYS−−−QTKMNARILQIEQEIEESGIYTHTLEELTYGAKMAWRNSNRCIGRLFWESLNVIDAR−−−−−−−DVQDESSFINSIHQHLSLATNGGKIKPTITIFSAE−−−−−NPPKIFNNQIIRYAGYDD−−−−−MGDPAERDVTRLAQHLGWQG−−NHTDFDVLPLIFQIPGKRVTYHELPSELVKEVDIIHEH−−−−YPKLKALNLKWYAVPIISNMNLVIGGITYTCAPFNGWYMVTEIAVRNFTDSYRYNLLEKVADAFNFDTLKNNTFNKDRALVELNYAVYHSFKSQGVSIVDHLTASKQFELFQQKEAQAERQVTGKWSWLAPPLSPTLTDNYHHGF−−NNEMKDPNFYYKKN 
fig|396513.4.peg.1485   Staphylococcus carnosus subsp. carnosus TM300     KATEFINTMYDELDYS−−−QEEKTKRLNEIENEINESGTYRHTTEELTYGARMAWRNSNRCIGRLFWETLIVQDAR−−−−−−−DVESNEAFIDAINTHLKEATNGGKIKSYITVFSQD−−−−−NPPTIYNNQLIRYAGYED−−−−−KGDPAEKEITQLAEHLGWQG−−EGTDFDVLPLIYKLPHENQMRMYELPSELVLEVPIEHRN−−−−YPRLKELGIKWYAVPIISNMDLKIGGITYGTVPFNGWYMVNEIAVRNFTDSYRYNLIEKVADAFEFDTLKNTSFNKDRIVVELNDAVYHSFKKNGVSIVDHLTAAKQFEHFERNEEHAHRKVTGKWSWLVPSLSPTLVPNYHHGY−−SNEMREPNFFYKKKA
fig|1131257.3.peg.887   Staphylococcus saprophyticus subsp. saprophyticus KACC 16562     EAKSFIETMYNELNYD−−−KNKITERIAEIESAILSTGTYEHTFEELNYGAKMAWRNSNRCIGRFFWDSLTVSDAR−−−−−−−HIQSEDEFIEAIENHIDIATNNGRIKPYITIFSKD−−−−−NPPQIYNNQLIRYAGYET−−−−−CGDPAEKKITKLAQHLGWQG−−QYTHFDILPLIYKMPNSKIKYHEYPKNLIKEVSITHDR−−−−FPKLQQLGLKWYAVPIISSMDLKIGGITYPTAPFNGWYMVNEIAVRNFTDVYRYNLLESVAEAFEFDTLKNNSFNKDRALVELNDAVYHSFKNAGVSIVDHLTASKQFERFEMNETKHDREVTGKWSWLAPSLSPTLVPNYHHGY−−KNVMKEPNFFYKKTE
fig|458233.11.peg.1796   Macrococcus caseolyticus JCSC5402     EAKAFITQFYKEQCFS−−−EQLMKARIKDVERKIEETGTYTHTSEELEYGARVAWRNSNRCIGRLFWDKLKVIDNR−−−−−−−HIESEAAFIEAIEHHIKSATNDGMIIPTITIFADAH−−−KQRIKLYNDQLIRYS−−−−−−−−−−DDPIVRETKALIEHTGYTN−−FG−−−KFLPLLYSIDGTFKTHDINPDIIKEVTITHPE−−−−HEAFNQLNLAWYAVPIISSMDLKIGGLTYPLVPFNGWYMESEIASRNFLDDYRYDKMKGIAEAFGFDTTTTTSYWRDRTVVEMNYAVYHSFKQHGVSIVDHYTASRQFARFEQNEADEGRSVTGDWTWLIPPISPSIVHNFHKGY−−KNIYNNPNFYYKKK 
fig|525367.9.peg.111   Listeria grayi DSM 20601     EAQTFLTRMYQEKQYS−−−AEALKNRLQTVMQEIEATGTYTHTTEELESGAKMAWRNNNHCIGRLFWNTLQVVDAR−−−−−−−EADTLDRVKAYLFSHLEKATNNGRIKPYITIFKPD−−−−−−TVKIWNHQLIRYAGYRAEEEQIGDPHSNSFTELCLKLGWQA−−PKTDFDILPLLVQVDSKTPPKLIDIPQKLVKEVPMTHPD−−−−YPAFDELGLKWYAVPIISDMVLEIGGIIYQAAPFNGWYMETEIGARNFADEDRYNLLPQMADIMALDRKRTDTLWKDRALVELNVAVLHSFHQAKVQIVDHHTAAKQFGTFEEKELAAGRELTGNWAWLIPPVSPATTAIFHRRF−−DNTIKKPNFFYRKN 
fig|1315975.3.peg.3329   Bacillus subtilis PS216     EAKAFIAACYQELGK−−−−EEEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRR−−−−−−−DVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRG−−ERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPD−−−−IEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSY−−DNSIVKPNYFYQDKP
fig|224308.1.peg.763   Bacillus subtilis subsp. subtilis str. 168                           MKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRR−−−−−−−DVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRG−−ERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPD−−−−IEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSY−−DNSIVKPNYFYQDKP
fig|703612.3.peg.2398   Bacillus subtilis subsp. spizizenii ATCC 6633     EAKAFIAECYQELGK−−−−EEEVKDRLDSIKSEIDRTGSYVHTKEEIEHGAKMAWRNSNRCIGRLFWNSLNVIDRR−−−−−−−DVRTKEDVRDALFHHIETATNNGKIRPSITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASRSLTAACEQLGWRG−−ERTDFDLLPLIFRMRGDEQPVWYELPRSLVIEVPITHPE−−−−IEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGISTNYNTDLWKDQALVELNKAVLYSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSY−−DNSIVKPNYFYQDKP
fig|326423.3.peg.756   Bacillus amyloliquefaciens FZB42     EAKDFIDVCYQELGM−−−−ESQINARLHAIKDEIDRTGSYVHTAEELEHGAKMAWRNSNRCIGRLFWQSLNVIDRR−−−−−−−GVNTKEEVRDALFEHIEIATNGGKIKPTITIFPPEKNGEKQVEIWNHQLIRYAGYETEKGRVGDPASYELTAVCEKLGWRG−−KRTDFDILPLLFRMKGDGQPVWYDLPQTLVKEVPITHPD−−−−IEEFADLNLRWYGVPIIADMRLEIGGLSYNAAPFNGWYMGTEIGARNLADEKRYDMLKKAAAVMGISASLNTDLWKDQVLVELNKAVLYSYKKHGVSIVDHHTAANQFKRFEEQEQDAGRKLTGDWTWLIPPISPASTHIFHKSY−−DNTIVKPNYYYQDKP
fig|279010.13.peg.775   Bacillus licheniformis ATCC 14580     EAKAFIELCYGELSKS−−−EEETRMRLHKIDKEIRETGSYTHTLEEIEHGARMAWRNSSRCIGRLFWHSLTVIDQR−−−−−−−GVQTEAEVRDALFHHIQLATNGGKIRPFITVFPPEQNGQKKVSIWNHQLIRYAGYETEQGVIGDPASLELTKACEALGWKG−−EGTPFDVLPLVFQIDGRPPVWYELPREIVKEVRIEHPE−−−−IEGFKSLGLKWYAVPIIADMKLEVGGIHYNAAPFNGWYMGTEIGARNLADADRYNALEKVAAIMGLDTERNTSLWKDKALVELNTAVLHSYKKAGVSIVDHHTAASQFKRFEEQEAEAGRELAASWTWLIPPLSPAATHIFHSYY−−ENKTLKPNYFYQEKP
fig|536229.4.peg.1686   Bacillus pumilus ATCC 7061     EAEAFISVCYEELGKS−−−NEEKAARLHEIKQEINSKGMYTHTQEELAHGAKMAWRNSNRCIGRLFWSTLHVHDCR−−−−−−−HVKTEEEVKEALFHHIEYATNDGKIKPSITIFPPENHAQKEVVIYNHQLVRYAGYETEYGIIGDEASLELTKLCEAHGWKG−−EGTHFDILPLMFQLKDQPPVLYELPKEIVQEVEITHPE−−−−YEGFRDLGLKWYAVPIIADMKLEIGGIHYNAAPFNGWYMGTEIGARNLADENRYNMLKKVASILELDTAKNASLWKDKAIVELNVAVLHSYREAGVTIVDHHTAAHQFKQFEKQEEKADRKLTGDWTWLIPPVSPAATHIFHKHY−−DNTIVKPNYFYQEKP
fig|315750.8.peg.724   Bacillus pumilus SAFR-032     EAEAFISVCYEELGKS−−−NEEKAARLHEIKQEINSKGTYTHTQEELAHGAKMAWRNSNRCIGRLFWSTLHVHDCR−−−−−−−HVKTEEEVKEALFHHIEYATNNGKIKPSITIFPPENDSQKEVIIYNHQLVRYAGYETEYGIIGDEASLELTKLCEAHGWKG−−EGTHFDILPLMFQLKNQPPVLYELPKEIVQEVEITHPE−−−−YEGFRDLGLKWYAVPIIADMKLEIGGIHYNAAPFNGWYMGTEIGARNLADENRYNMLKKVASILGLDTTKNASLWKDKAIVELNVAVLHSYREAGVTIVDHHTAAHQFKQFEKQEEKADRKLTGDWTWLIPPVSPAATHIFHKHY−−DNTIVKPNYFYQEKP
fig|439292.4.peg.299   Bacillus selenitireducens MLS10     QAEAFIRQCYKELGK−−−−EDQTGMRIEEIRRSFDETGLYRHTGEELVHGAKMAWRNANKCIGRLFWDTLSVHDAR−−−−−−−DAVTEDDVYKALVEHLRTATNGGRIKPLITVFAPEKNGVQPVKLYNHQLIRYAGYEEDGTVTGDPHSVAFTRFCESLGWQG−−AGKDFDLLPLVFQVAGGEPVWRTVPDEVVREVRIRHPR−−−−IQGIEALGLKWYAVPAIADMDLEIGGIRYPAAPFNGWYMGTEIGARNLADEDRYNKLRDVALAAGIEAGSNASLWKDEALVILNQAVLHSFQEDGVSIVDHHTAAAQFRQFEKQEATEGRDVTGDWTWLIPPVSPATTHIFHETY−−DNTEKSPNFHYKSK 
fig|649639.3.peg.2973   Bacillus cellulosilyticus DSM 2522     KAKQFIVQCYGELGK−−−−VDEIENRLVVIEREIKESGLYEHTFEELEYGAKLAWRNSNKCIGRLFWNTLIVKDRR−−−−−−−QVNNVKEVFDALHEHLVDATNGGKIKPTITIFPPKYKNQDHVRIWNHQLIRYAAYDTKHGVLGDPMSLPFTKVCEELGWQG−−EGSSFDILPLVVQWKNDEPMLQELNSDAILEVKIIHPE−−−−ITQFEDLHLKWYAIPAISDMMLEIGGIEYTAAPFNGWYMGTEIGARNFADVDRYNMLPKIASIMGLETNRHSTLWKDRALVELNRAVLYSFKNSGVSIVDHHTAAEQFKQFEKREKECNRELTGDWSWLIPPVSPATTHIFHRQY−−NDKLVTPNFFRQQTP
fig|441769.6.peg.835   Bacillus coahuilensis m4-4     KALEYIHLFFEEVGGT−−−DEGRVKRETEILHEIEETGTYTHTFEELEYGAKVAWRNSNRCIGRLFWNTMKVRDAR−−−−−−−YVEHTDQVFDELTKHVQFATNEGKIKPTITIFPPS−−−−−GKVRIWNHQLARYAGEETEHGVLGDRDSVEFTKVCQELGWKG−−PSSHFDLLPWVVQMEGEAPVWKEVSSPLIKEVEITHPE−−−−IAGLQDLQLKWYAVPMIADMNLEIGGIDYQAAPFNGWYMGTEIGARNLADDNRYNMLPKVASIMGLDTSKAYTLWKDKALVELNVAVLHSYKEAGVSIVDHHTAAQQFKIFEQNEQQAGREVTGDWVWLIPPVSPATTHIFHKPY−−KRKWKSPNYYYQENA
fig|161544.4.peg.1417   Bacillus sp. SG-1     EAVSFIEDCYRELGK−−−−AEEIEARIQQIENEIETTGTYTHTYEELEHGAKMAWRNSNRCIGRLFWDTMHVRDAR−−−−−−−EASTEEEIFLELEEHLKYASNEGRIRPTITVFRPSSPTEAEIRIFNHQLIRYAGYKNEHGMTGDPASLDFTQKCEELGWRG−−KQTHFDILPWVVQIGDRTPVWKEVNLNHVLEVNLSHPE−−−−YNWFEDLGLKWYGVPIISDMRLEIGGISYKAAPFNGWYMETEIGARNLADEYRYDMLPKVGSCMGLDTSKASTLWKDKALIELNIAVLHSFKEAGISIVDHHTAAQQFKTFENKEKQCGRELTGDWTWLIPPVSPATTHVFHKSY−−KNEWKSPNYFYQEKA
fig|391037.3.peg.3429   Salinispora arenicola CNS-205     EAIEFISAYYKERKL−−−−−SDVANRIAGVLDEIATTGTYWQTSAELAYGARAAWRQSARCIGRARWSGLQVRDRR−−−−−−−AVTTINGIDSELAEHLRVADNGGRIRSVITVFAPDHPQTGPRARIWNDQLIRYCGWQLDDEVLGDPAQQGMTEAALQLGWKPPDVASRFDLLPWVIETATEDPTVIDVPRHLVREVALAHPD−−−−HAWFADLGLQWHAVPVIANMRLRIGGVNYSCAPFNGHYLADEIGTRNMCDAGRYNQLRTVAAGLGLNTENEASLWREHAALLINQAVLHSFRDAGVRISEPHRESELFMRFCAHEEQAGRPVYGDWSWLNGSVGWAALHAVHHRYY−−DTRMPNPNFWPRART
fig|1169167.3.peg.4091   Salinispora arenicola CNR107     EAIEFISAYYKERKL−−−−−SDVANRIAGVLDEIATTGTYWQTSAELAYGARAAWRQSARCIGRARWSGLQVRDRR−−−−−−−AVTTINGIDSELAEHLRVADNGGRIRSVITVFAPDHPQTGPRARIWNDQLIRYCGWQLDDEVLGDPAQQGMTEAALQLGWKPPDVASRFDLLPWVIETATEDPTVIDVPRHLVREVALAHPD−−−−HAWFADLGLQWHAVPVIANMRLRIGGVNYSCAPFNGHYLADEIGTRNMCDAGRYNQLRTVAAGLGLNTENEASLWREHAALLINQAVLHSFRDAGVRISEPHRESELFMRFCAHEEQAGRPVYGDWSWLNGSVGWAALHAVHHRYY−−DTRMPNPNFWPRART
fig|219305.4.peg.290   Micromonospora sp. ATCC 39149     EAVEFLHLFHTERRL−−−−−PGVAERVAQVREEVALTGTYRHTREELTYGAKVAWRQSARCVGRVRWAGLRVRDRR−−−−−−−DVTTVAGIAAELTRHLAEADNGGRIRSVMTVFAPDRPGVGPRARIWNDQLIRYCGHRCADGAVVGDPAQAPMTDAVVGLGWRPPPVPGRFDLLPWVIETAYEDPTLVEVPRDLVREVALTHPA−−−−YPWFGGLRLRWHALPVISNMRLRVGGVDYGCAPFNGHYLSDEIGTRNMGDGHRYDQLLPVARGLGLDTSREDTLWREHAALVINQAVLHSFRLAGVRVSDPHTESELFMRFCAQEERAGRPVHGDWSWLNGSVGWAALHAVHHRYY−−DTRVPNPNLWPVDRA
fig|446462.5.peg.6720   Actinosynnema mirum DSM 43827     EAEDFVRLHHSEHPE−−−−AGSVDARLAEVHAEVAATGTYRHTHEELVFGARVAWRNSARCIGRLYWRSLKVRDLR−−−−−−−DLRDPKAVADECVEHLKLAGNGGRIRPVLTVFAPDEPDRPGPRVHNEQLIRYAGYLGADGGVLGDRRNVGLTAEAVAMGWKPPSHRGPFDVLPLIVSREDAEPHLLELPPEAVLEVPMKHPE−−−−LPWFRALGLRWHAVPAISNMRLRIGGVDYPASPFNGWYMGTEIGARNYADKDRYDLLPYLAKRMGLDTSSVRTLWQDRVLVELNRAVLHSFEEAGVTIADHHTESDRFLTHVAKEEAVGRQVPADWTWIVPPMSSGLTSVFHRYY−−SKDELLPNFFPGDTT
fig|405948.6.peg.6688   Saccharopolyspora erythraea NRRL 2338      AEKFLRAFHDAHPE−−−−AGELDPRLAEVRAEIARTGTYRHTPEELAYGARVALRDSGWCTSGVPWRRLLVRDLR−−−−−−−GLRNATTVAKECFEHLRLATNAGRIQPLISVFAPDTPHEPGPRIWNEQVVRYAGYAGPGGEVLGDARYVGFTAAAQRLGWRPPKTRGRFDHLPLVVETAHEGPRTFTVPRDLVQEVPLEHPD−−−−LPWFYKLGLRWHSVPLVSNMRLLIGGITYPAAPFNTWFVGTEIGTRALADEMAYGFIREVADRIGLDTTSERTLWRDRAIVEINRAVLYSFDSARVTITDHHSET                                                           
fig|405948.6.peg.5371   Saccharopolyspora erythraea NRRL 2338     EAEDFLRLFHAENRD−−−−SGSLQYRIDRMRYEVETVGTYRHTEAELAFGARVAWRNSARCIGRLYWKSLKVRDLR−−−−−−−DVHTVADIAGHCVQHLRQATNGGKIRPVISIFPPDTPSRPAPRIWNEQLIRYAGYERRDGSVLGDPRYRGFTAAVRSFGWHPPREPGAFDVLPLVVETAEEGAHMFALPRDAISEVPLRHPD−−−−LRWFGALGLRWHAVPVISNMRLSIGGVSYPAAPFNGWYMGTEIGARNLADPGRYDLLPVVAERLGLDTSRPDALWKDRALVELTRAVQHSFHEAGVTITDHHTESERFLTHVRREEAAGRKCPADWSWIVPPMSGGQTPVFHRYY−−DTEPQLPDFFTDEDA
fig|465541.3.peg.5996   Streptomyces sp. Mg1     EAEEFLRQFHTEHPEQ−−−PVPLARRLHQVRAAIDTAGTYRHTPGELAFGARVAWRNSRRCIGRLYWNSLRVLDRR−−−−−−−EAKTPGEIHRYLCDHLRQATNRGRIRPVISVFAPDAPGRPGPRIWNDQLIRYAGRRRGDGTVEGDAGYVDFTERVRDLGWQG−−PDGPFDILPLVVDTADDKPKLFELPHDLVMEVAITHPD−−−−CPRIAELDLRWHAVPAISNMRLRIGGIDYPLAPFNGWYMGTEIGARNLVDEGRYNLLPAVAACLGLDTSREGTLWRDRALVELNVAVLHSFRAAGARMSDHHTESRRFLTHLAREEREGRTVPADWTWIVPPLSGGITPVFHRSY−−DDADQRPNFYP    
fig|479432.4.peg.1555   Streptosporangium roseum DSM 43021      AADFLRLFHAENPA−−−−AGPVEPRLREVRAEIYMTGTYTHTPEELTFGARVAWRNSSRCIGRLYWHSLQVRDRR−−−−−−−GVNTAEGVAVECVNHLREAAPNNKVRPTITVFAPDRPGRPGPRIWNEQLIRYAGYAMDDGSVIGDPRYVDFTTMVRKLGWPGGPGSHFDVLPLLVSAGNGPPLMCTVPGDAVLEVPLSHPS−−−−YRWFESLGLRWHAVPAISNMCLEIGGIHYRAAPFNGWYMGSEIGARNLADIDRYDLMPIMAHLLGLDATNDRSLWRDHALVELNVAVLHSFEQAGVTMTDHHTESRRFLTHVAREEKAGRVCPADWSWIVPPISGSATPVFHRYY−−DEAELSPSFVHHPDS
fig|479433.5.peg.1758   Catenulispora acidiphila DSM 44928     EADRFLHECYTELDR−−−−TAELPARRRAVAAAIHTSGTYDHTFAELEYGARVAWRNSSRCIGRLYWQSLKLRDHR−−−−−−−DTDRPLRIAAECVSHLREATNGGRIRPTITVFAPDRPGRPGPRIRNEQLIRYAGYKVEDGGVVGDPRNIELTDTVRTLGWYG−−HGTAFDVLPLVIEAPGYRPYIHVIPQDSVLEVPLSHPR−−−−HPWFADLGVRWHAVPVISDMCLEIGGLHYPCAPFNGWYMGTEIGSRNLADTDRYDLLPTIAANLGLDTTTDRTLWRDRALVELNVAVLHSYEAAGVTIADHHTEAHRFLKHVAKEERAGRVCPAEWSWIVPPLSGSATAVFHRYY−−DEVDVRPNFVRHEGP
fig|253839.3.peg.149   Streptomyces sp. C     EAEEFIRLFHRENPQ−−−−AGDPRARLAAVRAELAETGTYRHTPQELVHGARVAWRNSNRCIGRLYWNSLRVRDRR−−−−−−−GLTDAEDIAAECFEHLREATNGGRVRPTITVFAPDTPDRPGPLIWSEQLVRYAGYGDHHSITVGDARNAPLTEALLGLGWSGGAGTPFDLLPLVVQGVDDKPRWFDTPADAVLEVPIRHPDE−−−RDDWSEWGLRWHAVPAISNMCLEIGGIHYPAAPFNGWYMGTEIGARNLADTDRYNLLPAVARRLGLDTSSERSLWKDRALVELNRAVLDSFDRAGVTIADHHTESRRFLSHLEREERKGREVGADWSWIVPPISGAATPVFHRTY−−EDRPSSTAYVHHPGA
fig|465541.3.peg.5962   Streptomyces sp. Mg1      AEEFIRLFHRETPG−−−−AGDPRTRLAAVRAELAESGTYRHTPQELVHGARVAWRNSNRCIGRLYWNSLRVRDRR−−−−−−−GLTDSDAIAAECFEHLREATNGGRVRPTITVFAPDTPQSPGPLIWSEQLVRYAGYGDHHSVTVGDARNAPLTEALLRLGWSGGAGTPFDLLPLVVQGVDDKPRWFDTPADAVLEVPIRHPDGDGGGDGWADWGLRWHAVPAISNMCLEIGGIHYPAAPFNGWYMGTEIGARNLADADRYNLLPAVGRRLGLDTSSDRSLWKDRALVELNRAVLHSFDRAEVTIADHHTESRRFLTHLEREERRGRDVGADWSWIVPPISGSATPVFHRTY−−EDRQVSPAYVHHPGA
fig|227882.9.peg.1631   Streptomyces avermitilis MA-4680      ATAFLTLHHTEER−−−−−LGDPARRIAAAHAEIAETGTYRHTTEELVFGARVAWRNANRCIGRLYWHSLCVRDRR−−−−−−−DVRDAKDVAEASADHLREATRDGRIRALITVFAPDAPGRPGPRIWNEQLIRYAGYARPGGAVTGDPRNAGLTALARRLGWPGGPGSPFDVLPLIVQSAGDRPRWFTLPEDAVLEVALTHPE−−−−YPWWRSLGLRWHAVPALAGMCLESGGICYPAAPFNGWYMGTEIGARNLADADRYDLLPHLADRLGLDTRSDRSLWKDRALVELNRSVLHSFDRAGVTVTDHHTESLRFLTHLDREERKGRRVGADWSWIVPPISGSATPVFHRTY−−ETVERHPAYVHHPEA
fig|227882.1.peg.1532   Streptomyces avermitilis MA-4680      ATAFLTLHHTEER−−−−−LGDPARRIAAAHAEIAETGTYRHTTEELVFGARVAWRNANRCIGRLYWHSLCVRDRR−−−−−−−DVRDAKDVAEASADHLREATRDGRIRALITVFAPDAPGRPGPRIWNEQLIRYAGYARPGGAVTGDPRNAGLTALARRLGWPGGPGSPFDVLPLIVQSAGDRPRWFTLPEDAVLEVALTHPE−−−−YPWWRSLGLRWHAVPALAGMCLESGGICYPAAPFNGWYMGTEIGARNLADADRYDLLPHLADRLGLDTRSDRSLWKDRALVELNRSVLHSFDRAGVTVTDHHTESLRFLTHLDREERKGRRVGADWSWIVPPISGSATPVFHRTY−−ETVERHPAYVHHPEA
fig|479431.5.peg.2000   Nakamurella multipartita DSM 44233     EAAEFQGLLLREGLID−−−QVAHGRRLRQINTELAATGRYEHTASELEQAGRIGWRATPRCIGRLPWQTLQVLDRR−−−−−−−HLQTPEEVFQACVEHLRWATNGGRIRPVMTVFAAAETG−−RAARIWNPQLIRYAGWRRPDGTVLGDPAQLELTDRLHELGWRPAQRTAFTVLPVVIQVGHHRSQLFELPADAVLEVPITHPE−−−−FSWFAELGLRWHALPMVCNLGLRAGGLFYPAAPFNGWYMSTEIAARNLADVDRYDQLPAIARRMGLNTRSSISLWRDRALVELNVAVLHSFKAAGVRMVDHHSASAQFMTHLDRERDQGRSTPGDWSWLVPPVSGSTSPVFHRYYAADADPGTPRFQAQPEA
fig|243230.1.peg.2775   Deinococcus radiodurans R1     DMRAFLRRFHEEMGE−−−−−PGLPARL−−−−RAVEEAGLWWPTSAELTWGAKVAWRNSTRCVGRLYWEALSVRDLR−−−−−−−ELNTAQAVYEALLQHLDDAFCGGHIRPVISVFGP−−−−−−−GVRLHNPQLIRYA−−−−−−−−−−DDPINADFVDKLRRFGWQP−−RGERFEVLPLLIEVNGRAELFSLPPQAVQEVAITHPV−−−−CLGIGELGLRWHALPVISDMHLDIGGLHLPCAFSGWYVQTEIAARDLADVGRYDQLPAVARALGLDTSRERTLWRDRALVELNVAVLHSFDAAGVKLADHHTVTAHHVRFEEREARAGREVRGKWSWLVPPLSPATTPLWSRRY−−RAREESPRFVRARCP
fig|546414.3.peg.1515   Deinococcus deserti VCD115     EAESFIRQYHVETRR−−−−−PGIETRLSAWARD−−−−−−PVLTEEELAYGARVAWRNSTRCIGRLPWAALQVRDRR−−−−−−−YVTQPDEIFTELIEHLRMAYAGGKIRPVISVFGP−−−−−−−GVRIVNDQLLRYAGYVQADGTVIGDPQNVALTQYLQKLGWAGGKGTSFDLLPVAIQSDTGRTELFTLPQDVTQEVLITHPD−−−−CPAIGDLGLRWPALPVISNMTLSVAGQHMTCAPFNGWYLQTEIAARNLADEHRYNMLPAVAQALGLDTSRRRSLWQDRALVELNVAVLHSFDQAGVRISDHHAVTRQFERFAAEEARAGRRVRGRWSWLIPPLSPATTPVWSRQY−−LDQEITPNFVRQTPA
fig|68909.1.peg.2332   Deinococcus geothermalis DSM11300     EAEQFLTLYHEESGL−−−−−PGLTARLVEVWDEVGRTGSYTLTSSELTYGARVAWRNSTRCVGRLPWRSLEVRDLR−−−−−−−HVTRPDDVFTHLLTHLRAALNGGRIRPIISIFGP−−−−−−−DVRIHNDQLLRYAGYRQPGGGVVGDPQNVPLTEHLRRLGWTGGPGTPWDVLPLAVEGRGRVRLFSLPEDATCQVPITHPE−−−−VPALGGLGLRWFALPVLSRMTLEVGGLSFPAAPFNGWYVQTEIAARNLADEERYNMLPAVARALGLDMRRDRTLWRDRALVELNVAVLHSFDRAGVRIADHHAVTRQFVRFEEAEARAGRAVRGRWSWLIPPLSPATTPVWHRSY−−VDGDESPRFVPQPPA
fig|234621.6.peg.1860   Rhodococcus erythropolis PR4                                    RELHRTGTYTHTAEELLVGAKLAWRNHARCVGRAHWRTLKLIDAR−−−−−−−DAVTASALAEACWEHLRLSTNGGALQSVVTVGPLPREDGQEYRILSPQLIRYAGYRQPDGTILGDPWHVDLTAQVTAMGWKG−−AGTAFDVLPVLISVPDEPLQYFDVPTDLVLEVEIEHPE−−−−YSWFADLGLKWHAVPAVSDMNLDIGGIVYPCTPFSGWYVSTEVGARNFSDTDRYNMLPTIGAMMELDMSHDRTLWKDRALVELNRAVIHSYRKAGVIMVDHHTVAKQFIDHIAREDKAGRKCPTDWSWVNPPMSSSLTPTFHRLYDEPDLDIRPNFVTKKK 
fig|596309.3.peg.4536   Rhodococcus erythropolis SK121                                    RELHRTGTYTHTAEELLVGAKLAWRNHARCVGRAHWRTLKLIDAR−−−−−−−DAVTASALAEACWEHLRLSTNGGALQSVVTVGPLPREDGQEYRILSPQLIRYAGYRQPDGTILGDPWHVDLTAQVTAMGWKG−−AGTPFDVLPVLISVPDEPLQYFDVPTDLVLEVEIEHPE−−−−YSWFADLGLKWHAVPAVSDMNLDIGGIVYPCTPFSGWYVSTEVGARNFSDTDRYNMLPTIGAMMELDMSHDRTLWKDRALVELNRAVIYSYRKAGVIMVDHHTVAKQFIDHIAREDKAGRKCPTDWSWVNPPMSSSLTPTFHRLYDEPDLDIRPNFVTKKK 
fig|101510.15.peg.2818   Rhodococcus jostii RHA1     E−−−−−−−FFSEPEL−−−−AHLPTARLADALESLAETGRYEHTVEELEVGSQLAWRNHARCVGRKHWRTLKLIDAR−−−−−−−HVTTADEIAEACWEHLRVATNGGALRSVITVGPLPLADGREYKIVSPQLIRYAGYRNADGTVTGDPAQVGITEAVTKMGWRG−−AGTPFDVLPLLISTPDEPLRWYDVPPDLVLEVEIEHPD−−−−YAWFADLGLKWHAVPAVSNMSFSVGGLTYPLAPFSGWYVSTEVGARNLSDQDRYDMLPAIAERLCLDTTSERTLWRDRALVELNRAVIHSYRQAGVHMVDHHTVAKQFISHVEREESLGRKCPTDWSWINPPMSAALTPTFHRLYDAPDMDIRPNFLPAATA
fig|632772.3.peg.2433   Rhodococcus opacus B4     E−−−−−−−FFSEPEL−−−−AHLPTARLADALESLAETGSYEHTVEELEVGSQLAWRNHARCVGRKHWRTLKLIDAR−−−−−−−HVTTADGIAEACWEHLRVATNGGALRSVITIGPRPLADGREYKIVSPQLIRYAGYRNADGTVTGDPAQVGITEAVTKMGWRG−−AGTRFDVLPLLISTPDEPLRWFDVPPDLVLEVDIEHPD−−−−YTWFADLGLRWHAVPAVSNMSLSVGGLEYPLAPFSGWYVSTEVGARNLSDTDRYDMLPAIAEKLGLDTSSERTLWRDRALVELNRAVIHSYRQAGVHMVDHHTVAKQFISHVEREESLGRKCPTDWSWINPPMSAALTPTFHRLYDAPDTTIRPNFLPAPAA
fig|504472.7.peg.6230   Spirosoma linguale DSM 74     QAKEYIDQISVELAWD−−−TVDYERRWEEIKREVLATGSYTHTYEELAYGAQLAWRNASKCIGRISWRNMVVRDLR−−−−−−−HVTDPDEMFRECAEHLRIATNGGNVQIVMNVFRPKKPMERWGPRIWNSQYIRFAGYEQPDGTVLGDRANLKLTKTLIRQGWIPPTEKTAYDTLPLVIDVPGQPPRLYQFADDDVLKVAIEHPT−−−−YPAMTALDLQWCAIPAISNFRMNIGGIQYGCIPFNGWFMETEIARNLWEEGRYEKAEAIAKAIGLDTSSEQTLWRDRAFLELNVAILHSFSKAKVTLVDHQTASRQFLTHDQREKRAGRECPAQWSWVVPSAGGSVTPVWHHEM−−RDFHLSPSYHYAAD 
fig|504472.5.peg.6201   Spirosoma linguale DSM 74     QAKEYIDQISVELAWD−−−TVDYERRWEEIKREVLATGSYTHTYEELAYGAQLAWRNASKCIGRISWRNMVVRDLR−−−−−−−HVTDPDEMFRECAEHLRIATNGGNVQIVMNVFRPKKPMERWGPRIWNSQYIRFAGYEQPDGTVLGDRANLKLTKTLIRQGWIPPTEKTAYDTLPLVIDVPGQPPRLYQFADDDVLKVAIEHPT−−−−YPAMTALDLQWCAIPAISNFRMNIGGIQYGCIPFNGWFMETEIARNLWEEGRYEKAEAIAKAIGLDTSSEQTLWRDRAFLELNVAILHSFSKAKVTLVDHQTASRQFLTHDQREKRAGRECPAQWSWVVPSAGGSVTPVWHHEM−−RDFHLSPSYHYAAD 
fig|91464.3.peg.4812   Synechococcus sp. PCC 7335     KAREYLDVIANEQAWE−−−ESDRERRWQEIKAEVQATGTYTHTYEELAYGAQLAWRNTSKCIGRIQWSNMVVRDRR−−−−−−−HVTDPDEMFQELEEHLRLGTNGGNIQIVMTVFRPKLPKERWGPRIWNPQLIRYAAYEMPDGSIMGDAANLELTHQIIEKMGWQPPEPRSPYDILPLVIEVPRHEPRLYSFAPEEILEVEIEHPT−−−−IPDFKTLGLRWYAVPAISNFRMDIGGVTYACLPFNGWYMGTEIARDFLEGGRYGKMKAIANLLGLNTSSEQTLWRDRVALEMNIAVLHSFQKAKVTMVDHQSAAQQFLAHDLREKRAGRECPADYGWVVPPAGGSACPVWHHQM−−RDFYLEPAYHHAAD 
fig|10228.3.peg.1401   Trichoplax adhaerens                             ARLEQIIEDVEQTGFYEQTYSELVFGAKLAWRNATRCIGRIQWSRLKVFDAR−−−−−−−HVKTTDEMFQAICEHLKYATNNGNLRSVLTIFAPRNGSKQNDFRIWNAQLIRYAGYKMDDGSIIGDRATVEFTELCLSFGWRG−−SGGRFDVLPLILQANGGEPQFYEIPPELVLEVCLRHPK−−−−YPWFENLGLKWYALPAVANMMFDVGGIEFPCAPFNGWYMGTEIGSRDLGDTYRYNVCETVGQHMGLDTKNNSSLWKDKALVELNIAVLYSFQEDNVTIVDHHSVSESFMNHLEHEVNCLRGGCPSDWVWLVPPLSGSASEVYHQEL−−LSYRLKPSFEYQVNP
fig|10228.3.peg.1053   Trichoplax adhaerens     EAKDFLMEYYASLRKE−−NTEAHLKRQADVIDEIQAKGLYELTEQELTYGCRLAWRNASRCIGRIQWGNLHVFDAR−−−−−−−DAVTPEDMFNAITDHVKYATNKGNIRSSITVFPPRRDSMHDFRVWNVQLIRYAGYEQADGSVIGDPSNIEFTKICQSYGWRG−−NGGMFDVLPLLLQANGTEPHLFEIPEELILEVPISHPE−−−−YDWFEELKLRWYALPAVSCLLLDIGGVEFPACPFNGWYMVTEIGARDLGDTNRYNLCKPVAQYLKLDTRSETTLWRDKAIVELNRAVMHSFLKHKVTLVDHHTASNTFMQHLDNEQKLRGGCPADWVWIVPPISGSATKVYHQEM−−LNYKIKPSFEYQEDP
fig|10228.3.peg.9225   Trichoplax adhaerens     EATEFLQEYYASIRKE−−GSEAHLKRKADVIEEIQAKGLYDLTEQELTYGARLSWRNASRCIGRIQWSNLHIFDAR−−−−−−−DAVTATDMYDAIISHLKYGTNNGNLRSAMTIFPPRANDSHDFRVWNIQLVRYAGYEQPDGSVIGDPANVEFTKICESYGWKG−−KGGMFDVLPLLLQANGEDPELFEIPSDLVLEVPISHPE−−−−YEWFEELKLRWYALPAVSCLLLDIGGVEFPACPFNGWYMVTEIGARDFGDENRYNLCKPVAQRMKLDTRTETTLWRDKAIVEINCAVMHSFLKHGVTLVDHHSTSNSFMQHLQNEQKLRGGCPADWVWVVPPISGSATKVFHQEM−−LNYKIKPSLEYQVDA
fig|7227.3.peg.1907   Drosophila melanogaster (Fruit fly)      AKDFLEQYFTSIKRT−−SSTAHETRWKQVRQSIETTGHYQLTETELIYGAKLAWRNSSRCIGRIQWSKLQVFDCR−−−−−−−YVTTTSGMFEAICNHIKYATNKGNLRSAITIFPQRTDAKHDYRIWNNQLISYAGYKQADGKIIGDPMNVEFTEVCTKLGWKS−−KGSEWDILPLVVSANGHDPDYFDYPPELILEVPLTHPK−−−−FEWFSDLGLRWYALPAVSSMLFDVGGIQFTATTFSGWYMSTEIGSRNLCDTNRRNMLETVALKMQLDTRTPTSLWKDKAVVEMNIAVLHSYQSRNVTIVDHHTASESFMKHFENESKLRNGCPADWIWIVPPLSGSITPVFHQEM−−ALYYLKPSFEYQDPA
fig|10090.3.peg.24823   Mus musculus (House mouse)      AIEFINQYYGSFKEA−−KIEEHLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDAR−−−−−−−NCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKP−−RYGRFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPK−−−−YEWFQELGLKWYALPAVANMLLEVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEM−−LNYVLSPFYYYQIEP
fig|9606.3.peg.13372   Homo sapiens (Human)     QAIEFVNQYYGSFKEA−−KIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDAR−−−−−−−SCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKP−−KYGRFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPK−−−−YEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM−−LNYVLSPFYYYQVEA
fig|9606.3.peg.8322   Homo sapiens (Human)      AKEFIDQYYSSIKRQVFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDAR−−−−−−−DCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKP−−PRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPK−−−−FEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM−−LNYRLTPSFEYQPDP
fig|9606.3.peg.8323   Homo sapiens (Human)      AKEFIDQYYSSIKRQVFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDAR−−−−−−−DCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKP−−PRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPK−−−−FEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM−−LNYRLTPSFEYQPDP
fig|10090.3.peg.11255   Mus musculus (House mouse)     QARDFINQYYNSIKRS−−GSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDAR−−−−−−−DCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLIRYAGYRQQDGSVRGDPANVEITELCIQHGWTP−−GNGRFDVLPLLLQAPDEPPELFTLPPEMVLEVPLEHPT−−−−LEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSEIGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEM−−VNYFLSPAFRYQPDP
fig|9606.3.peg.29705   Homo sapiens (Human)     QARDFINQYYSSIKRS−−GSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDAR−−−−−−−DCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTP−−GNGRFDVLPLLLQAPDDPPELFLLPPELVLEVPLEHPT−−−−LEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEM−−VNYFLSPAFRYQPDP
fig|485913.3.peg.3729   Ktedonobacter racemifer DSM 44963        AYLSLYYREQEG−−−−FDGFIPRMARIHDEIMQTGTYWQGEKELAHGARVAWRNNSRCIGRLHWNSLAVRDMR−−−−−−−HVQTAEEIYEALVEHIRVATNGGKIRSTISIFAPQVPGEPGIRIWNPQLIRYAGYRQPNGLLIGDPMLEELSEVARQLGWQGGPGTPFDVLPLIIQMPHQQPMLFELPHDVILEVPLTHPE−−−−YAWFEDLGLKWHALPVISNMRLEVGGVSYTAAPFNGWYMGTEIGARNLGDVERYNLLPVIAEKMGLKTRLDRELWKDRALVELNIAVLSSFTQHGVTIIDHHTASRQFMHHQRNEEEAGRVLPADWSWIVPPMSGSVTPVFHIPY−−KDCTLSPNFFPQQDP
fig|644076.3.peg.78   Silicibacter sp. TrichCH4B     EAEAFLRQYYFEEGA−−−−ETPYEIRIDDIRSQIEATGTYSHTQAELSFGARLAWRNSARCIGRFFWQSLTVRDRRILGEGLGEAQLAHAIFEDLLEHIRFATNGGDIRAALTVFRPR−−−−DPEIRILNPQLILYAGHRNSDGTFIGDPKNVELTELAKALGWQP−−SGTCFDVLPLMIRIGTSLPYIFEIPKSEILEVELHHPD−−−−ETSVASLGLKWFALPAVSDMALDLGGITYSAAPSNGFYMGTEIGSFNIADPQRYAQLENFAHAMNLDTSGVNPLWRDQAMVEINRSVLHSFRCAGVRILDHHALSEWFRRFREDEEQKSRPVYGHWPWIVPPMSANLSHIWHNADLKKVMLKPGFFYQNR 
fig|448385.11.peg.1453   Sorangium cellulosum So ce 56     EAEAFLRQCYAELGV−−−−PSAVEERWQEVRASLEKHGTYTHLPDELAYGARLAWRNSSRCIGRFFWSTLHVRDLR−−−−−−−HLKTEEEIFQALVEHLDLATNGGDIRATMTVFRPG−−−−EPRIRIWNGQLVRYAGYRLPEGGVLGDPGNVELTDQALALGWPGGERTRFDLLPLIIQIGEGRPKWFELPREKVLEVPIEHPR−−−−YAWFAELGLKWHALPAVSNLALDLGGIQYTAAPFNGFYMGTEIGARNLSDVTRYDQLPLIADRLGLDRTRSDTLWQDAALVELNVAVLHSFRQAKVRMMDHHTLSEYFKKFEQQERQCERPVYADWTWIVPPMSASTMAVFHTNM−−ENKILKPNYLYQDDP
fig|348780.3.peg.1149   Natronomonas pharaonis DSM 2160     EAKSFIEQCYTELGR−−−−ESEIDDRLAEIEAEIERRNHYEHTPEELEHGAKMAWRNSNRCIGRLFWQQLNVADER−−−−−−−DCETAEAVHEACCRHLEKARNGGDIKPLITVFKPMVDGDRQVRIWNYELLRYAGYRTDDGIVGDPDEIELTDYCQSRGWEG−−DGTDFDILPHVIQMGDDEPAIFEVPDSAVGEVPLRHPD−−−−YEWFEDLGLRWYDVPVVSNMRLELGGIHYTAAPFSGWYVSTEIGARNLADEDRYDMLPTVAERLGLDTDDNRSLWKDEALVELNRAVLHSYEEAGVTIVDHHTVTDQFEQFEQNEAEADREVTGDRSWLLPPMSSATTHVFSNDY−−DDRIEKPNFFYQAAP
fig|360911.3.peg.1001   Exiguobacterium sp. AT1b     QASDWMRQWH−−−−−−−−−−DDPSERLRQIKDEIERTGTYSLTTEELCEGAKVAWRNSNRCIGRLFWQTLHVIDAR−−−−−−−DADTFEAVYDHLVDHLRFATNGGKIRSTMTVLP−−−−−−−NEFKLLNTQLIRYAGYETPDGIIGDPMSVTMTKRAKELGWVG−−AGTPFDILPLMITDG−−RDVRLFELPNEAVLEVDI