(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00008107

fig|156586.6.peg.1453   Flavobacteria bacterium BBFL7     RDVLVKSVLNQYNNI−−−−−−−DNAQNSLNNITLLKNENTFTITTGHQLNLFTGPLYFLYKIISVVNLCKKLKTAYPNYNFVPIYWMATEDHDFEEIQYFKF−−−−−−−QGKKVVWDK−−−−−DASG−−−−GVGRLSTEGLK−−DVLKIFQNEL−−−−GVSINSSEIIELFKTAY−−−−−−−−−−−LENEDLATATRILAHQLFREDGLVIVDGDDRNLKSLM−−SSHFKDELINRTSYYKVSEVIDKWPT−−−−DYKVQVT−−PREINLFYLKDR−−−LRERIVF−−ENGQYNVV−−NTEISFSEKEILVELDQFPERFSPNVIMRPLYQETILPNLCYVGGGGEMAYWLELKEYFNSQKITFPILLMRNSALIISRKEHEKIQKLDLEI−−−−−−−−−−−DDLF−−−LKDYELDEKLTRKLSEIDID−−−−FTVQKKHLQDQFKELYALAHKTDPS−−−−−−−FKGAVAAQERKQIKGLEHLEKRLLKAQKRKLRDYLLRASDIQKQLFPNSSLQERQENFSSFY
fig|156586.3.peg.1290   Flavobacteria sp. BBFL7     RDVLVKSVLNQYNNI−−−−−−−DNAQNSLNNITLLKNENTFTITTGHQLNLFTGPLYFLYKIISVVNLCKKLKTAYPNYNFVPIYWMATEDHDFEEIQYFKF−−−−−−−QGKKVVWDK−−−−−DASG−−−−GVGRLSTEGLK−−DVLKIFQNEL−−−−GVSINSSEIIELFKTAY−−−−−−−−−−−LENEDLATATRILAHQLFREDGLVIVDGDDRNLKSLM−−SSHFKDELINRTSYYKVSEVIDKWPT−−−−DYKVQVT−−PREINLFYLKDR−−−LRERIVF−−ENGQYNVV−−NTEISFSEKEILVELDQFPERFSPNVIMRPLYQETILPNLCYVGGGGEMAYWLELKEYFNSQKITFPILLMRNSALIISRKEHEKIQKLDLEI−−−−−−−−−−−DDLF−−−LKDYELDEKLTRKLSEIDID−−−−FTVQKKHLQDQFKELYALAHKTDPS−−−−−−−FKGAVAAQERKQIKGLEHLEKRLLKAQKRKLRDYLLRASDIQKQLFPNSSLQERQENFSSFY
fig|313603.3.peg.563   Flavobacteriales bacterium HTCC2170     RAVLYDSLQEQYKGF−−−−−−−AISKKTKANLIQLKEPITFTVATGHQLNLFTGPLYFLYKIISTINLTVELKKAYPKFNFVPVYWMATEDHDFEEINYFNF−−−−−−−NNKKLQWDN−−−−−EATG−−−−GVGRLNTKDLE−−SVLEAFASSL−−−−GKGKNAEYLIKLFVDSY−−−−−−−−−−−LEHENLAQATRFLANSLFGSYGLVIVDGDDHKLKRLL−−APYAKKDILESISFSKVSDTISKFRQLPEKYNVQVN−−PREINYFYLKDN−−−IRERIIK−−EGEGFKVN−−DTDIYFTKEELLIELDTYPERFSPNVITRPLYQEIILPNLCYIGGGGELAYWLELKESFEAFEIDFPIILLRNSALVVSSKQKSKLEHMNLAA−−−−−−−−−−−PDLF−−−MGQHSFINKKIREISNIEID−−−−FSEQKKHLSEQFKALYTIAEKTDKS−−−−−−−FYGAVKAQESKQLKGLDNLEKRLLKAQKRKLKDHVQRMTEIQNELFPNGSLQERSLNFSELY
fig|313598.3.peg.785   Tenacibaculum sp. MED152     RKVLASALTEQYDMF−−−−−−−QVSEETKSNIELLKEENTFTITTGHQLNLFTGPLYFLYKIFSTINLCEQLSEEFPDKNFVPIYWMATEDHDFEEINYFNF−−−−−−−DGKKVAWNR−−−−−KDGG−−−−AVGRFSTEGLK−−DVFDVFSEHL−−−−GNSKNAIYLKSLFTKGY−−−−−−−−−−−LEHNNLADATRFIANEIFKAYGLVIVDGDDAQLKTLF−−APFVKQEFQQESSFKAVSKSIHELEK−−−−NYKIQVN−−PREINLFYLGEG−−−FRERIIF−−EDELFKVL−−NTEYSFTKEEILLEVERNPLAFSPNVIMRPLYQEVILPNLCYIGGGGELAYWLELKGYFNEVHIPFPILLLRNSVQVISEKQAGKLEKLNISK−−−−−−−−−−−KEIF−−−LNQFDLISAKVVANTDIETD−−−−FSDKIEYLKNQFKDLKEVAKKTDVT−−−−−−−FLNAVNAQERKQVKGLENLEKRLLRAEKRRQKDLVDRITLLQNEILPNESLEERQRNFSNYY
fig|313594.4.peg.1804   Polaribacter irgensii 23-P     RLVLVDALKKQYTQF−−−−−−−EVSEKTQENINLLKLQNTFTVTTGHQLNLFTGPLYFLYKIISTINLSEELRRKFPENNFVPIYWMATEDHDFDEINYFNF−−−−−−−EGKKVKWSR−−−−−DDGG−−−−AVGRFSTDGLE−−HVFEVFASQL−−−−GNSKNANYLKELFSKGY−−−−−−−−−−−LEHNNLAAATRYIANDLFKEFGLVILDGDAAELKKLF−−IPFVKDELENGTSFKEVSNTITKLEI−−−−NYKIQVN−−PRDINLFYLSEN−−−SRERILH−−EDGVYKVN−−NTSLQFSKSEILKEVEQNPVAFSPNVIMRPLFQEVILPNLGYVGGGGEIAYWLELKDYFEKVNIPFPILLLRNSVQVISEKQQKKLDKLAVSH−−−−−−−−−−−ADLF−−−EKQHALLAKKVIENSEIEIS−−−−FEDKMRYLKNEFSELKEVAKKTDIS−−−−−−−FVNAVNAQERKQLKGLENLQKRLLKAEKRRQVELVDRITILQNQLLPNQSLEERQVNFSEYY
fig|376686.10.peg.5148   Flavobacterium johnsoniae UW101     RIALVNTLKKQYQNI−−−−−−−EISDSTKQNIELLALENTFTITTGHQLNLFSGPLYFLYKIISTINLTKELKSKYPSYNFVPVYWMATEDHDFEEINYFNF−−−−−−−KGKKFRWNK−−−−−ESNG−−−−PVGRLSTEGLA−−EFLDIYSLEL−−−−GSSTNANTLKKLFEDTY−−−−−−−−−−−LKHDNLADATRFLANSLFANYGLVIIDADDADLKRAF−−IPYAKEELEKQTSYKAVQETIEQLKE−−−−−YTVQVN−−PREINLFYIEDN−−−LRERIIF−−EEDKYFVN−−NTKISFSKDQILSELENHPEKFSPNVIMRPLYQEIILPNLCYIGGGGEIAYWLELKSFFDAVNITFPMILVRNSVLLATEKQAKKADQLNLSW−−−−−−−−−−−KDLF−−−TKQENLVNAITHKISAFPID−−−−LTPQKEILKTQFQYLYELAAQTDKS−−−−−−−FSGAVKAQEVKQTKGLENLEKRLLKAQKRNLSDQLQRVIDLQCELFPNNSLQERQSNFSEFY
fig|391598.3.peg.247   Flavobacteria bacterium BAL38     REILVSELEKQYANF−−−−−−−VLSESTLHNIKLLKQSNTYTITTGHQLNLFTGPLYFLYKIVTTINLCKELKKSYPTENFVPIYWMATEDHDFEEINYFNF−−−−−−−NEEKIQWKK−−−−−ESNG−−−−PVGRLETSELN−−LVFETFSSKL−−−−GLGNNATYLKELFKKSY−−−−−−−−−−−LEHENLADATRYLANELFKNEGLVILDGDSKELKKIF−−LPQLKEELKNQTSFKKVNETILKLKE−−−−−YNIQVN−−PREINLFYIQNK−−−LRERIIF−−ENGSYLIN−−NTKLKFTEQELLVELENHPENFSPNVILRPLYQEVILPNLCYIGGGGEIAYWLELKSNFEANKITFPILLVRNSVLLATEKQVSKLDKLNVCW−−−−−−−−−−−NDVF−−−LSQNKLLDKKTKEFSAFIID−−−−FSEQKETLRKQFEALYEIANKTDKS−−−−−−−FLGAVKAQEIKQLKGLDNLEKKLLRAEKRIHTEKLNSILKIQDELFPNHGLQERTANFAAFY
fig|402612.5.peg.1421   Flavobacterium psychrophilum JIP02/86     RKILVDALKKQYTNF−−−−−−−EISELTQKNIVLLENEKTFTITTGHQLNLFTGPLYFLYKIVSTINLCKELKRNYPEYNFVPIYWMATEDHDFEEINHFNF−−−−−−−KGKKLSWNT−−−−−ASKG−−−−AVGRLSTKSLT−−NFFTVFKAEL−−−−GLSNNAEYIKKLFSDSY−−−−−−−−−−−LQHSNLADATRFLANKLFGKYGLVILDGDAAALKKQF−−IPYIKDELLYQNSNKKVLESIAKLKD−−−−−YSIQVN−−PREINLFYIEAN−−−LRERIIY−−ENGNYKVN−−NTFISFSETEILKLVDANSEKFSPNVILRPLYQEVILPNLAYIGGGGEIAYWLELKAMFDFHKVTFPILLVRNSAVLINEKQEKNRQKLNITW−−−−−−−−−−−QELF−−−LKQQVLIDAKTKEYSEIKID−−−−FSEQKAHLKKQFEALHQIALKTDKS−−−−−−−FSGAVKAQEKKQTKGLDNLEKRLLKAEKKMHSEKLKKIIELQNNLFPNESLQERKSNFSEIY
fig|391603.3.peg.2074   Flavobacteriales bacterium ALC-1       VLVNVIKQQYSKL−−−−−−−KTSELTLEHIESLEKEKTFTITTGHQLNLFTGPLYFLYKIISTINLTKQLKEAYPKYNFVPIYWMASEDHDFEEINYFNF−−−−−−−RGKKIQWNS−−−−−NQTG−−−−AVGHFNTKGLD−−KVFKIVSAEF−−−−GAGKNAEQLKKWFKEAY−−−−−−−−−−−LNHDNLADATRYIANALFGDHGLVILDSDHKDLKRLF−−IPNIEKELIEQTAFKHVSETNKTLEDL−−ELKIQVN−−PREINFFYIDKD−−−LRERIVY−−EDDKFKVN−−NTNISWSKSELLKHLNEVPERFSPNVIMRPLYQEVILPNLCYIGGGGEMIYWLQLKSNFEAHNVTFPMLLLRNSALVKTVKQSQKLKNLNVLD−−−−−−−−−−−QDLF−−−LDRSSFINKKVRAISNIDID−−−−FSKQIQHLERQFKGLYILAEQTDKS−−−−−−−FIGAVKAQEIKQSKGIKHLEKRLLKAQKKKLEDQISRCTELQEQLFPRQSLQERNTNFSELY
fig|391587.3.peg.1683   Kordia algicida OT-1     RAILSNALVKQYENV−−−−−−−NASKTTLKNIQKLALENTFTITTGHQLNLFTGPLYFLYKIISTINLTTTLQEKHPNHHFVPIYWMASEDHDFDEICFFNY−−−−−−−KGKKIRWER−−−−−EASG−−−−AVGELSTEGLA−−EVLEDFSKKI−−−−GISDNAKYLQSLFEDGY−−−−−−−−−−−VKHNNLTDATRYIANELFKKYGLVIVDGNDKELKKLF−−IPFVENELFQQTAYKKVLETAEHLTKVNDSYKIQVN−−PREINLFYINNG−−−IRERIIE−−HEGVFMVN−−NTSVRWNSEQIKAEVHAHPERFSPNALLRPLYQEIILPNLCYIGGGGELAYWLELKSYFETVNVTFPMLLLRNSAVVKTQKQSEKMGKLNISN−−−−−−−−−−−RDLF−−−LKKEDFIAKKVKELSKIEID−−−−FTPQKEHLQQQFEDLYKLAEQTDKS−−−−−−−FIGAVAAQEKKQLKGLNHLEKRLLTAQKRMLKDKVSRSTELRETLFPANSLQERKQNFSELY
fig|655815.4.peg.2822   Zunongwangia profunda SM-A87     RKVLVESLKKQYNGV−−−−−−−EISDATLDHIEALSKDTTFTITTGHQLNLFTGPLYFLYKIISVINLTKILKKKHPEYDFVPIYWMATEDHDFAEINYFNL−−−−−−−NGKKFQWNS−−−−−TEKGAGIDAVGYLSTEGLK−−EVFELFSSEI−−−−GGGKDAEYLKFLFKNAY−−−−−−−−−−−LKHSNLTEATRYLANELFKEYGLVIMGAQQPELKKLF−−IPFAENELLEQRSFKTTKENTEKLSNL−−GYNVQVN−−PREINLFYLNNG−−−YRERIIK−−RDGRFYVH−−EKQIEWTKEEIIAELHEQPQHFSPNVMMRPLFQEVILPNLCYIGGGGELAYWLELKDYFEAENVPFPMLLLRNSALLQTEKQKEKRKKLDISN−−−−−−−−−−−KELF−−−LKQHELINRKVRKISNIDID−−−−FSKQKEYLVNQFQEMYDLAQKTDKS−−−−−−−FLGAVKAQEVKQLKGLDHLEKRLLKAQKRKLKDEVSRIAALQNQLFPNKSLQERQTNFSEVY
fig|411154.5.peg.2119   Gramella forsetii KT0803     RKDLIQVLNDQYSKL−−−−−−−TVSENTRANIDALESKNTFTVVTGHQLNLFTGPLYFLYKIISTINLTKKLKEKYPENNFVPIYWMATEDHDFEEINFFNL−−−−−−−NGKKFKWNNADDRAGKT−−−−AVGGLSTEGLD−−EVFKLFSAEI−−−−GGGENAEFLKSTFEKGY−−−−−−−−−−−LEHDTLSDATRFIANEIFGKYGLVIVAAGDKRLKKHF−−IPNVGSELVEHSSHKQTTETLQKINSL−−GYNIQVN−−PRDINLFYLTDE−−−IRERIIE−−RDGNYFVH−−ETEISWTKEEILQELKDHPERFSPNVMTRPLYQEVILPNLCYIGGGGELAYWLELKSYFEAENVTFPMLLLRNSAMLQTGKQNDKREKLKISI−−−−−−−−−−−QELF−−−LKQHELINRKVRKISDIDID−−−−FSGQKEHLVEQFQHMYDLAEKTDES−−−−−−−FIGAVKAQEVKQLKGLDHLEKRLLKAQKRKLKDEVERIAELQNDLFPNRSLQERQTNFSEFY
fig|411154.11.peg.2155   Gramella forsetii KT0803     RKDLIQVLNDQYSKL−−−−−−−TVSENTRANIDALESKNTFTVVTGHQLNLFTGPLYFLYKIISTINLTKKLKEKYPENNFVPIYWMATEDHDFEEINFFNL−−−−−−−NGKKFKWNNADDRAGKT−−−−AVGGLSTEGLD−−EVFKLFSAEI−−−−GGGENAEFLKSTFEKGY−−−−−−−−−−−LEHDTLSDATRFIANEIFGKYGLVIVAAGDKRLKKHF−−IPNVGSELVEHSSHKQTTETLQKINSL−−GYNIQVN−−PRDINLFYLTDE−−−IRERIIE−−RDGNYFVH−−ETEISWTKEEILQELKDHPERFSPNVMTRPLYQEVILPNLCYIGGGGELAYWLELKSYFEAENVTFPMLLLRNSAMLQTGKQNDKREKLKISI−−−−−−−−−−−QELF−−−LKQHELINRKVRKISDIDID−−−−FSGQKEHLVEQFQHMYDLAEKTDES−−−−−−−FIGAVKAQEVKQLKGLDHLEKRLLKAQKRKLKDEVERIAELQNDLFPNRSLQERQTNFSEFY
fig|398720.4.peg.365   Leeuwenhoekiella blandensis MED217     REVLVKAVRNQYKNI−−−−−−−DLHDAVDNALNRLALPNTFTVTTGHQLNLFTGPLYFLYKIVSTINLAKQLSRTYPEQDFVPVYWMATEDHDFEEINYFNF−−−−−−−RGKKIKWNRADIQDNDKG−−−−AVGELSTEGLS−−EVYQLICSEF−−−−GTTKMGTSLCTLFEEAY−−−−−−−−−−−LKHDNLTEATRFLANSLFAAYGLIIVDGNDADLKRVF−−MPYLKQELLEQKAFDTVQKQAEALQKA−−GYGVQVN−−AREINLFYLADG−−−LRERIIE−−KEGSFFVN−−DTELKFSKEELLLELENHPERFSPNVIMRPLYQEVILPNLAYIGGGGELAYWLELKTFFDEVEVQFPMLMLRNSALLITDKQQQKLEKLDLSI−−−−−−−−−−−ADLF−−−LDQNDLVNRKIRKISNIDID−−−−FSPQKQHLVRQFEALYNIAEETDAS−−−−−−−FIGAVKAQEVKQLKGLEHLEKRLLKAQKKKLSDHVKRFVAIQNELFPQENLQERTTNFSEFY
fig|50743.3.peg.2277   unidentified eubacterium SCB49     RKVLVAQLNSQYKGV−−−−−−−AVSESTQNNIDALANANTFTITTGHQLNLFTGPLYFLYKIISVINLSEELNVAYPDKHFVPVYWMATEDHDFDEINYFNF−−−−−−−RGKKVVWDR−−−−−PDGG−−−−AVGEFTTEGLQ−−RVFLAFENELKESFGFTKNAKQLLKLFKEAY−−−−−−−−−−−LDHGTLSEATRYIGNQLFKDFGLVIVDGNDKLLKSAF−−VPYAKKELLEHLSFNKVSQTTAALVKS−−GYGEQVH−−PREINLFYLIEG−−−VRERIIE−−TDGMFMVN−−DTDITFTEKEILMELEAHPERFSPNALLRPLYQEVILPNLCYTGGGGELAYWFQLKDYFKSVEVPFPILLLRNSAVLILEKEIKSLGKLGLKL−−−−−−−−−−−EDLF−−−KKQIDLQADYTRKISEIEID−−−−FTKQREHLKLQFKEMYTIAENTDAS−−−−−−−FIGAVAAQEKKQLKGLNHLEKRLLKAQKRKYKELLDKVTRLQNSVFPQQSLQERNTNFSEFY
fig|313590.6.peg.1089   Dokdonia donghaensis MED134                                                                                       PIYWMATEDHDFDEINYFNF−−−−−−−QGKKVQWNR−−−−−EDGG−−−−AVGELSTDGLA−−EVLALFKTQL−−−−GTSRNAEYLSKLFNDAY−−−−−−−−−−−LNHDNLADATRYLGNELFGEYGLVIVDGNDAGLKELF−−APYVQRELLEGVSHAKVTQQTEQLTAL−−GYPEQVH−−PREINLFYITKG−−−IRERIIK−−VDDMYVVN−−DTDIRFRENEILNELANHPERFSPNALLRPLFQEVILPNLCYIGGGGELAYWFQLKTYFEEVGVPFPALLLRNSALIRTEKQRTKAENLGVSL−−−−−−−−−−−PNLF−−−LKQNELINRKVRAISNIEID−−−−FSAQRSFLKEQFKAMYLLAEETDAS−−−−−−−FIGAVKAQEVKQLKGLENLESRLLRAQKRKLSDHVQRLVDLQNEVFPMQSLQERNTNFSQFY
fig|313590.3.peg.2959   Cellulophaga sp. MED134     RKRLYDSLIAQYKNT−−−−−−−NTSAKTQLNLEHLASENTFTITTGHQLNLFTGPLYFLYKIISVINLCKELKEKDPDRNYVPIYWMATEDHDFDEINYFNF−−−−−−−QGKKVQWNR−−−−−EDGG−−−−AVGELSTDGLA−−EVLALFKTQL−−−−GTSRNAEYLSKLFNDAY−−−−−−−−−−−LNHDNLADATRYLGNELFGEYGLVIVDGNDAGLKELF−−APYVQRELLEGVSHAKVTQQTEQLTAL−−GYPEQVH−−PREINLFYITKG−−−IRERIIK−−VDDMYVVN−−DTDIRFRENEILNELANHPERFSPNALLRPLFQEVILPNLCYIGGGGELAYWFQLKTYFEEVGVPFPALLLRNSALIRTEKQRTKAENLGVSL−−−−−−−−−−−PNLF−−−LKQNELINRKVRAISNIEID−−−−FSAQRSFLKEQFKAMYLLAEETDAS−−−−−−−FIGAVKAQEVKQLKGLENLESRLLRAQKRKLSDHVQRLVDLQNEVFPMQSLQERNTNFSQFY
fig|216432.7.peg.196   Croceibacter atlanticus HTCC2559     RRILVEVLKEQYQNI−−−−−−−ETSSETQQAIQLLAEDTTVTITTGHQLNLFSGPLYFLYKIISTINLSEKLSENYKDINVVPVFWMATEDHDFEEINHFTL−−−−−−−HGKKFKWSPERYSDNANG−−−−AVGRFTTEGLE−−DVLKLLKAEL−−−−GVGHQAEYLVKLFEDTY−−−−−−−−−−−LNHNTLAEATRYLTNELFAKYGLVILDADHPKLKQLF−−VPTVLDELQHQTSYKAVTNTSKHLESA−−NYPVQVS−−AREINLFYLTET−−−SRERIVN−−VDGTFGVV−−DSDKIWNTDQELFEEVSAHPERFSPNVIMRPLYQETILPNICYIGGGGELAYWFELKTYFDKVEVPFPVLLLRNSVLLRTDKQYGKQQKLRVSN−−−−−−−−−−−EELF−−−LKQHELINRKVRQISNINID−−−−FSTQKAHLKDQFEAMYALAEKTDAT−−−−−−−FLGAVKAQEVKQLKGLDHLEQRLLKAQRLKLKDEVSRLVALQNELFPLKSLQERTINFSEFY
fig|313596.4.peg.1781   Robiginitalea biformata HTCC2501     RSTLCTVLEDQYRGL−−−−−−−SASPATKSHIAALADSATVTVVTGHQLNLFTGPLYFHYKILGTIALCRKLQAAYPDHIFVPVYWMATEDHDFDEINHFNF−−−−−−−KGKEFRWNR−−−−−EAGG−−−−PVGRMETDGLE−−VLAEQFMQDL−−−−GPGDRARELKELFEAAY−−−−−−−−−−−LEHPNLAAATRYLANRLFGEEGLVVLDGDDPRLKALF−−APHMETDMLEGLAHRQVSDQAAGLQAADPDYPIQVT−−PREINLFYMRDG−−−LRERIVE−−EDGVYGVL−−ETDIRMDREALKKELREHPGRFSPNVITRPLYQEVILPNIAYIGGGGEIAYWLELKSYFEASEIPFPILMLRNSALVLSDKQARKAEKLGVSL−−−−−−−−−−−QELF−−−LEQNELINRKVRAISGIDID−−−−FTPQREHLRKQFRDLYALAEKTDAS−−−−−−−FLGAVKAQETKQINGLNHLEKRLLKAQKRKLRDHVNRLVALQGELFPNGSLQERTRNF    
fig|553178.3.peg.1155   Capnocytophaga gingivalis ATCC 33624     RTLLFQVLKEQYQNL−−−−−−−SISEKTHNHIEALQQEHTFTITTGHQLSLFTGPLYFIYKIVSTIVSCQQLKQLYPNYTFVPIYWMATEDHDFEEINHFTF−−−−−−−QGQKLSWHS−−−−−KEGG−−−−AVGTFSTEGLD−−KVASVLNILL−−−−GKSHQGESLKRLFEKAY−−−−−−−−−−−IEHATLAEATRYLVNELFAPYGLVIIDGDNPKLKGCL−−APYLKRELFEQLSQKEVKKTLSYIKQTDKSYPEQVH−−PREINIFYLSKG−−−IRERIVK−−ENGVYKVL−−NTHIEFTPEALEEELTQFPERFSPNVILRPLYQEIILPNLAYIGGGGEIAYWLELKTMFAVYGVPFPMLILRNSVLLVSDKQRKNIEKLGLSY−−−−−−−−−−−HNIF−−−LKNNILENKITQKLSEFPID−−−−FSSQKQMLEKQFADLLEIALHTDKS−−−−−−−FLGAVKAQEKKQLKGLEQLEKRLLKAQKKKYKEQLERILSLRISLFPKESLQERVDNFSEYM
fig|313595.4.peg.1747   Psychroflexus torquis ATCC 700755     RKVLVEVLKEQYQTL−−−−−−−SSSEDTKSHIESLQEPSTFTVTTGHQLNLFTGPLYFLYKIVSTLNLAKSLKENYPDFNFVPVYWMATEDHDFEEINYFNF−−−−−−−QQKKLEWKT−−−−−NAEG−−−−AVGHLSTAGLD−−ELSKSIETEF−−−−GKSDNAEYLKNLFKEAY−−−−−−−−−−−LNHETLAEATQFLANELFGDYGLVILDADDARLKSKF−−GKQIKNDLVYHTAFRQIEKQSDKLSKL−−GYSVQVN−−PREINLFYLHEK−−−TRSRIVQ−−KDENYYVL−−DTDLKFTKAEVLELVDQHPERFSPNVVLRPLYQEVILPNLAYIGGGGELAYWLELKSYFEAEQVTFPSLVLRNSVLLYSDKTSSKLNTLNAKI−−−−−−−−−−−QDLF−−−LSPDKLEAMHTKKLSKIDID−−−−FGKQKQVLEKQFEDLYELAKNTDKS−−−−−−−FYGAVAAQEKKQKNGLDHLEKRLLKAQKRRLKSENELVLKIQTVLFPKRSLQERSLNFSEIY
fig|487796.3.peg.1338   Flavobacteria bacterium MS024-2A     RAVLVKSLRDQYKVL−−−−−−−EPSAAVSKNLDLLALDNTFTITTGHQLCLMTGPLYFIYKIISTINLCGQLKKKFPEANFVPIYWMASEDHDFEEISSFRF−−−−−−−QDKSIKWHR−−−−−DAAG−−−−AVGDLPLDDLQ−−EVLNVFERHL−−−−GSHPEANTIKTWIQSSY−−−−−−−−−−−RCSKDLSEATFRLVDTLFGDKGLVIIEPNKAELKQLF−−TPILKEELIHQPSYSAVTTQIQRIQKEYNADYTPQVN−−PREINLFYLTET−−−GRYRIEK−−EGNEFLLN−−GTEQRFSSESFLKLLEDHPERFSPNVILRPVYQEVILPNLCYIGGGGELAYWFQLKSNFERFNIPFPVLLLRNSTLIYSKKQAKKIKNLEMEY−−−−−−−−−−−SELF−−−LKRNALINKKIRQISNIDLD−−−−LGFLKAELQKQFDYLDGLVKQTDKS−−−−−−−FKGAVAAQEVKQLNGLKHLEKRLLKAQKRVLSDQVSRMVNLHEQLFPNDTLQERSLNFMTLY
fig|553177.6.peg.2209   Capnocytophaga sputigena ATCC 33612     RNVLVSSLKTQYAEL−−−−−−−KTTPKVLKNIELLAQSNTFTVTTGHQLSLFTGHLYFIFKIISVINTVRQLTEKYPNKHFVPVYWMATEDHDFEEINHFHL−−−−−−−SNRTICWNS−−−−−DQTG−−−−ATGNFSTNTLK−−AVFQTFDRAI−−−−GLGKNADELRALFRDSY−−−−−−−−−−−LKNNNLAEATRYLVNALFEDYGVVVIDGNDKALKKEF−−IPYISNDLLHSVAHREVTKSIEALQKVNSTYPVQVN−−PREVNMFYLTPN−−−GRHRIIR−−TTEVFEVH−−DTNIRFSKEAILEELNTYPERFSPNVILRPLYQEVILPNLAYIGGGGEIAYWLELKGFFNKEKVPFPILMLRNSAILVSQRQAEKIEKLQLSL−−−−−−−−−−−NDLF−−−LKPEELKNKKVRQLSEFPID−−−−FTPEKELLQKQFNHLYQLAERTDIT−−−−−−−FKNAVKAQEVRQLKGLEKLEKRLLKAQKRKFSEELERTTILQSELFPNNILQERFANFTDFY
fig|521097.5.peg.1820   Capnocytophaga ochracea DSM 7271     RHILVSSLKEQYAEV−−−−−−−KTTPKVLKNIELLSKSNTFTITTGHQLSLFTGHLYFIFKIISVINTAKQLAEKYPDKHFVPVYWMATEDHDFEEINHFHF−−−−−−−NNRTICWNS−−−−−DQTG−−−−ATGNFATDTLE−−AVFQTFDKAI−−−−GLGKNANTLRTLFHDSY−−−−−−−−−−−LKNKDLASATRYLVNALFEAYGVVVIDGNDKALKRQF−−IPYISDDLLHSVAHTEVTKSIKALQTVNSSYPVQVN−−PREVNMFYLTEG−−−GRHRLVR−−TADGFEVH−−GTDIRFSEEGILEELRTYPERFSPNVILRPLYQEVILPNLAYIGGGGEIAYWLELKSFFNKEKVPFPILMLRNSAMLISQRQAEKLQKLQLSV−−−−−−−−−−−EDLF−−−LKTEDLKNKKVRQLSEFPID−−−−FTPEKELLHRQFEHLYELAKHTDVT−−−−−−−FENAVKAQEVRQLKGLDKLEKRLLKAQKRKFAEELEQTIFLQNELFPNGALQERFANFTDFY
fig|525257.3.peg.4405   Chryseobacterium gleum ATCC 35910     RNILAEVFESQLTSL−−−−−−−SLSARQKENLENLKLPNTFTITTGHQLNLFSGPVFFVYKILQTIKTCTYLKENFPDFNFVPMYWMASEDHDFAEINHFKT−−−−−−−ENNYYETNE−−−−−KSGG−−−−PVGRIEISDT−−−YFISEFEKEF−−−−KDSIFGTELILMMKEAY−−−−−−−−−−−KQGNTLTEAIKILVNRLFSEFGLLILDGDSVELKNQM−−KEIFKDELLHFSLHQASEAKVNFLTEK−−YGKVQVN−−PREINLFYLSE−−−−TRDRIEF−−DGQKYIIV−−DKGIHFTEEEILTELENHPEKFSPNALMRPVYQENVLPNLAYIGGNAEIMYWLELKDYFLKINTPFPILIPRNSMLFLKEKTLGKIEKLDLKI−−−−−−−−−−−EDFF−−−HNFTVLTNQKILKDSLILQL−−−−LEEKEELLVSNFSALKAAAETTEKS−−−−−−−FGNMVKAEEVRQLKSFKRMKKRLLHAEKIKQNELLERLENLFLDVHPAKTWQERVYNFSVFF
fig|531844.3.peg.2292   Flavobacteriaceae bacterium 3519-10     RQLLSEVLRSQYSGL−−−−−−−NLSEKQKINLEKLSDSQTYTVTTGHQLNLFTGPVFFIYKILQTIKLADHLNQTFPQRKTVPVFWMATEDHDFDEINHFNT−−−−−−−RGNYYESKA−−−−−EAGG−−−−SVGRIQPDDH−−−FFIAEFEKEF−−−−TDSVYGTELILMMKRAY−−−−−−−−−−−KKGSSLAQSTRILVHELFADYGLLVIDGDNAGLKSQM−−KAIFRGELLNSDLFETTKPTVSQLTER−−YGKVQVN−−PREINLFYLSE−−−−TRDRIEF−−DREKYIIV−−DKNISFSKDEILTELENHPEKFSPNALMRPVYQELVLPNIAYIGGNAEIMYWLELKLYFEKLALPFPVLIPRNSMLFVSAKTLSKAGKLGLKM−−−−−−−−−−−SDFF−−−RNFAEVTKGIVLDGNEILTA−−−−LEENETVLQAQFEKISDKAAMTDKS−−−−−−−FGTLVQAEKTRQLKSYQRMKKRLLRAEKIKQHEKMERLNNLFLEIHPGKSWQERVLNFSVFY
fig|485918.5.peg.6146   Chitinophaga pinensis DSM 2588     REVLVAALQEQYKEL−−−−−−−EINDKVRENIESLLDQQTFTITTAHQPNIFTGYLYFAYKILQTIKLADQLRSEYPKYNFVPVYYMGSEDADLDELGHVYI−−−−−−−DGKTINWPT−−−−−AQQG−−−−AVGRMQPEGFE−−DLIAAVKKAL−−−−GYGPYADELIALLEKAY−−−−−−−−−−−LGHKNIQEATLYLVNELFGRYGLVILVPDSPKLKQLY−−VPVMRDELFHQRSFDIVNETIAKLSK−−−−HHKVQAN−−PREINLFYLTET−−−SRERIVK−−VGDIWKVL−−HLPVEFTAAQLEKELEEYPERFSPNVILRGMLQETILPNIAFIGGGGEIAYWLELQQLFEHYKVPYPVLLLRNSFLLTDANSQQRLQKLGLSV−−−−−−−−−−−TDLF−−−EDPEELITRFVQEHTNAALV−−−−LKDEYTAIEKLFDDLVLKAGSIDVT−−−−−−−LEASVGAERTRAVKSIGKLEHKFLRAEKKKFTWQSEQIRTLKSRLFPANSLQERKENFMPWY
fig|391596.3.peg.2982   Pedobacter sp. BAL39     RSTLVDVLKKQYHNI−−−−−−−DASALVQQNIDLLTDDRTFTITTGHQLNIFTGPLYFIYKIVTAINLAKELKVQFPDYNFVPVYWMATEDHDFEEINHLKI−−−−−−−EDKKLSWNK−−−−−RAAG−−−−ATGRLNTADIT−−EVLNAYKGYL−−−−GISENGLKLAELTDRAY−−−−−−−−−−−AQNEKLADATRVLVDGLFGEYGLICVDADVHELKKQF−−AGIVEKDIIEQNSFKSISESNASLEDH−−GYRAQVN−−PREINFFYMTDG−−−FRERIVE−−ENGIYQVL−−NSDIRFSEVELKQEIESFPERFSPNVVMRPMYQEVILPNLAYIGGGAEVTYWLQLKSNFEHYGVAYPVLLLRNSALVIDKRSERKMQILAITH−−−−−−−−−−−KNLF−−−KDDETLKNDWIKAHVTLQLS−−−−LDDEERSIRAVFDQIKLNAYKIDKT−−−−−−−LGESADAAKTKALKLISRLEKKMLRAEKRKHDTSLSQIDDLKDKLFPNGVLQERVLNIAPIY
fig|485917.5.peg.257   Pedobacter heparinus DSM 2366     RDLLVETLQRQYASI−−−−−−−KTPAAVIKNIGLLNDKKTFTITTGHQLNIFTGPLYFIYKIVTAINLAADLKAEFPEYNFVPVYWMATEDHDFEEINHVKV−−−−−−−EDKMLTWNK−−−−−QAAG−−−−ATGRLGTADIE−−DTLIAYKGYL−−−−GISENGLCLSDRVDHAY−−−−−−−−−−−TGHEKLSDATRDLVNALFGKYGLVCIDADDHRLKQEF−−AEIIYKDITEQQSFKLISESNAALEAL−−GHKPQVN−−PREINFFYMTDK−−−LRERIVE−−EDGRYNVM−−NTDISFDQHTLKTEITNFPERFSPNVVMRPVYQEVILPNLAYIGGGAELTYWLQLKNNFDHYQIDFPVLLLRNSALVIDKPSETRMEILGISH−−−−−−−−−−−KNLF−−−SKTETLKNEWVKAHVNLQLS−−−−LDDEERAIRAVFDQIKLNAYKIDKS−−−−−−−LSQSADAAKTKALKLIASLEKKMLRAEKRKHKTSLAQIENLKEKLFPTGVLQERVLNIAPMF
fig|525372.3.peg.2295   Sphingobacterium spiritivorum ATCC 33300     RPLLVDQLRDQYTGLL−−−−−−ADAPAVEANITALLDENTYTVTTGHQLNIFTGPLYFIFKIITAIRLADDLKKAHPDKNFVPVYWMATEDHDFEEINHTRV−−−−−−−FGKKISWDT−−−−−PAVS−−−−ATGRMTTESIE−−EAVKQYKAIL−−−−GLSDNSCKLNDKVDKAY−−−−−−−−−−−IEHNNLADATRTFVHSLFKEYGLLILDADRRELKKVF−−APVIKEDILQEKSYKAIQKTSEELEEK−−GFSTQVH−−AREINFFYLTDT−−−YRERIVKLDDGRYEVL−−HQDVYFSREELEKEIDNYPERFSPNVIMRPMYEEIILPNLAYIGGGAEMVYWLQLKANFDQYAVDFPILVPRNSAMITDDTIAGKIFRLDLTF−−−−−−−−−−−KSIF−−−KPANTLKNDYVRRHTTHRLN−−−−LNDEWMELNAIFGKIKLRTHKIDPS−−−−−−−LGPSTDAVKARLKKAIKNLEKKLLKADKRNHNEALTQIERVKEKLFPGGGLQERTENFALLY
fig|525373.3.peg.2520   Sphingobacterium spiritivorum ATCC 33861     RPLLVDQLRAQYTDLL−−−−−−ADAPAVEANITALLDENTYTVTTGHQLNIFTGPLYFIFKIITAIRLADDLKKAHPDKNFVPVYWMATEDHDFEEINHTRV−−−−−−−FGKKISWDT−−−−−PAVS−−−−ATGRMATESIE−−EAVKQYKAIL−−−−GLSDNSCKLNDKVDKAY−−−−−−−−−−−IEHNNLADATRTFVHSLFKEYGLVILDADSRELKKVF−−APVIKEDILQEKSFKAIQKTSEELEEK−−GFSTQVH−−AREINFFYLTDT−−−YRERIVKLDDGRYEVL−−HQDVYFSREELEMEIDNYPERFSPNVIMRPMYEEIILPNLAYIGGGAEMVYWLQLKANFDQYAVDFPILVPRNSAMITDDTIAGKIFRLDLTF−−−−−−−−−−−KSIF−−−KPANTLKNDYVRRHTTHRLN−−−−LNDEWMELNAIFGKIKLRTHKIDPS−−−−−−−LGPSTDAVKARLKKAIKNLEKKLLKADKRNHNEALTQIERVKEKLFPGGGLQERTENFALLY
fig|388413.5.peg.1695   Algoriphagus sp. PR1     RKSLVEALRGQYEGI−−−−−−−DVQEAVTANINALSSENTFTVTTGHQLNLYTGPLYFIYKIVSTINLAKKLEAAYPENKFVPVYWMASEDHDFDEINYFKL−−−−−−−DGQKYQWNT−−−−−DQSG−−−−AVGDFILD−−−−−QSFKEFSKT−−−−−−−−−−VPFAADVFKEAY−−−−−−−−−−−GSSKTLAEAVRKYVNQLFGAQGLIILDGHDPILKTEL−−KEVMHADIFDHSAHARAQEATEGLESL−−GYKGQIF−−PRDINFFYLDKG−−−LRERIEK−−HGEEYVVL−−NTELKFSKEELQKQIEDNPERFSPNVVLRPLYQEMILPNLAYLGGPAEVVYWLQLKGVFDQFKVPFPIVLPRNFALLISAQIRKKIQQLGWND−−−−−−−−−−−EAIF−−−QDFASWKKEFVKEESNFDIE−−−−LNKERKELSSLFNQKGKEAASLDKS−−−−−−−LGGAFEAGKVRALKILDQMSVKLRKAEERNLNVQIERALAIQEFIKPGGAPQERVVNMMQFY
fig|269798.16.peg.678   Cytophaga hutchinsonii ATCC 33406     RTVLVERLKAQYKDL−−−−−−−PVSEKVQQNIERLASEHTFTITTGHQLCLGTGPLYLILKTLSCVKLCEALKTKHADNEFVPVFWMASEDHDAAEINHFYV−−−−−−−FGKKYTWET−−−−−TQTG−−−−AVGRFTTTGIS−−EVLETIKD−−−−−−−−−−−−−−IPAWLKDAY−−−−−−−−−−−QSSVTLAEATRKVMHQLFAEYGVVVIDGDDAALKKEF−−TAVIEKELFEQPAVAVMNQTNRSIERH−−GYSIQVN−−PRDINLFYVKDS−−−LRERIEK−−QGERFVVL−−HTDVSFSAGEIKKEVADHPERFSPNVVLRPLYESTILPDIAYVGGPGEIAYWLQLKEVFAVYNTFLPAIFPRMFSGVITKQQCVKLEKAHVTV−−−−−−−−−−−AELF−−−LSEFDLKQVVVSRSIQEEIS−−−−IEAEAGKITAAFDTIASIAATVDGS−−−−−−−LQSWAQAEKAKALKQLEDIEKKLRKAEERKHDDVIKSVLGIRDKILPNGKLQERQESVFTFL
fig|313606.3.peg.5116   Microscilla marina ATCC 23134     RQVLHKALTQQYQHV−−−−−−−PAPPQA−−QIDALLEDNTFTVTTGHQLNLATGPLYFVYKIAAAINTAKALKAKYPAYNFIPVYWMASEDHDFAEINHFNL−−−−−−−FGKTYTWNT−−−−−DQTG−−−−AVGQFNPENVA−−QIFEKINEP−−−−−−−−−−−−−KTDLFAQAY−−−−−−−−−−−AQHSSLSDATRYLVHQLFANTDLVILDADHTGLKKVF−−QPIIKKEVLTPASFDIVRQTSEKLDQL−−NYKTQVT−−PREINFFYLEGN−−−TRERIVR−−EGEEFKVL−−NTDLSFSPAQMEALIEQHPERFSPNVILRPLYQECILPNLSYIGGPSELVYWLQLKGVFEHFQCPFPLLQPRNFVLFVDHINHKKKEKLDLSI−−−−−−−−−−−ADLF−−−LDEVTLRKNFVLKNSENELK−−−−LDQEVATLNQAFASVVQKALEVDKS−−−−−−−LEGFIKSEQQKSLKSLGNIEKRLKKSEERKLETEINQLLKLKEKLFPNGAPQERKDNILSIY
fig|471854.4.peg.3752   Dyadobacter fermentans DSM 18053     RKTLVDVLTKQYRGL−−−−−−−−−−−PYLPDFSVLSQENTFTVTTGHQLNIFTGPLYIIYKIVTIIKLAEALRAKYPDYNFVPVYWMATEDHDFEEIASFHL−−−−−−−FGQTHKWTG−−−−−EHKG−−−−AVGKLNPKELA−−GILKQLPDK−−−−−−−−−−−−−−PLLFAKAY−−−−−−−−−−−LENDTLADAVRCYMHELFGRYGLVSLDADDADLKRHF−−LPVIQEELKDSISEKLVTETTSRLNAL−−GYHTPLH−−AREINFFYLDTN−−−LRERIVR−−EGDVFKVL−−NTELEFSEAELLALTESNPERFSPNVILRPLYEEVILPNLAYIGGPSEVPYWMQLKGVFEHFGVPYPMLMPRNFALYMNGHQYKKAQKLKIDY−−−−−−−−−−−KDLF−−−LDEIALRKTFIERNTEHELN−−−−LNEQKEAFNAIFDQILAKATEVDQT−−−−−−−MHGAVKAEQKRLLNSLKHLEKRIIRAEERNHESEIEQLLSLKNKLFPNGIAQERYDNLLNFY
fig|504472.7.peg.5344   Spirosoma linguale DSM 74     RRVLVDALERQYQHI−−−−−−−−−−−AVKPDVSTLLQPNTFTVTTGHQLNIFSGPLYIIYKLITTIKLARKLKETYPAYNFVPVYWMATEDHDFAEINHFSL−−−−−−−MGNQYVWET−−−−−EQRG−−−−AVGRMNPKELK−−TLFAQIPEK−−−−−−−−−−−−−−LALFEEAY−−−−−−−−−−−LKHDTLADATRYYVNELFGAEGLVCLDADDAALKRVF−−APVMRDELTHQQSGELVNKRTEELAAL−−GYKTVIA−−PRDINLFFLDDQ−−−LRERIERREDNTYQIL−−HTKQTFSESEILNLLDEHPEKFSPNVVLRPLYQETILPNLAYIGGPSEVPYWLQLKSVFEHYQTPFPILMPRNFAMYVPSVSAKRVAKLGLTP−−−−−−−−−−−EQLF−−−QDTLTLKREFVDNHTRHTLK−−−−FDNENKTVNKALDAILHKAQMVDPT−−−−−−−LERAVLAETKRFADAVARLEKKMRRAEERNQEVGIRHLLAVKNELFPNGGLQERSDNFLTF 
fig|517418.3.peg.1338   Chloroherpeton thalassium ATCC 35110     RPELVLELTRQNQLF−−−−−−−GSGPKTFERIQSLLSKKTLAVVTGQQVGFLTGPVYTIYKTLSAIVLTEKWHEHYPDFEFVPVFWLESEDHDYEEISHVS−−LLKGNSLERFSYSEASYQALSS−−−−AGATQITPEFLD−−WLGKEILEAF−−−−PESDYKQKMLTLVRESY−−−−−−−−−−−KEGVSYEMAFATLLARLFYDEGLIIVSSHPKGFKTLA−−KSVFIRELETFPASSQNIIAQSARLEES−−GYDAQAK−−PRPINLYFFQEN−−−QRLKIEP−−RRQGSVELL−−PGKTTFSQHEMLEFAHSAPELFSPNVVLRPIVQDTVLPTVAYVAGPGEISYFGQFLRNYQFFNIPMPIIYPRASLSLLEPKISRVFEKSARILNEKEISGSL−−SRFY−−−QNSQQFINELLLAASTVDIE−−DEATTAIQGLSDIFKKFGLKLSEIDPT−−−−−−−LAQSVEKVMQSTLNQVENLKSKTIKAEKQRHNDLIAQIEKSRDNLLPGGVLQERVLNGFHFF
fig|194439.7.peg.1411   Chlorobium tepidum TLS     REALVELLTEQNERF−−−−−−−DGSERQQREIEKLRSPRCMAIVTGQQTGLFTGPLYTIYKALTAVVLARKQKELFPEYDFVPVFWIESEDHDFDEASSTV−−LFSGGGLEQITAEAAHRL−−PDQ−−−−MAGATQLGASIG−−ATVQEFLDLL−−−−PDTEFKPEIAEILESCY−−−−−−−−−−−EPGVTFEIAFARTMNRLFREHPLILLSAQDTRFKQLA−−VEVLCREVETAPASSYDVVAQSSILESM−−GYPAQTK−−PRAVNLFYLNQLG−−QRLKIEQ−−PSPDNFLIV−−PDRQRYTRHQLLEICQDHPEKFSPNVILRPIVQDAVLPTFAYIGGPGEISYLAQFRKAYEHFGLSMPFVIPRGSFTLVEPKIARTMDKVLKATGRPSFSRRQVYEAVF−−−EDVQELRKSMVSGGDSQKLD−−ALFEQVESEVTRSLSTLEPALVKMDPT−−−−−−−LQAALSASSGQITKIIGTIKEKTYRAGRRKHDELLQQLDKAELNLFPDGKPQERSINIFHYL
fig|517417.5.peg.395   Chlorobaculum parvum NCIB 8327     RNALVELLLKQNSRF−−−−−−−GGSERQRQEIEKLRSSRCMAIVTGQQTGLFTGPMYTIYKALSAVVIARKQKELFPEYDFVPVFWIESEDHDFDEASATA−−LFAGAGLETIQAEGGHRQ−−QDQ−−−−MAGPTPLGSGIT−−ETVREFLDLL−−−−PDSDFKPEIAELLHSAY−−−−−−−−−−−TPESTFEIAFATTMNRLFSNHPLILLSTQDAEFKRLA−−APMLCKEIESAPASSYDVVAQSSTLESM−−GYPAQTK−−PRAVNLFYLNQLG−−QRLKIEQ−−PSPENFMIL−−PDRQRYTRHQLLEFCQDHPERFSPNVILRPIVQDAVLPTFAYIGGPGEVSYLSQFRKVYERFGLVMPFVIPRGSFTLVEPKITRTMDKVLKVTGKPSFSRRQVYEALF−−−GNLQELRKSMVSGAENQNLD−−ALFEQVESEVTRSLSTLEPALVKMDPT−−−−−−−LQQALAGSSGQIAKIIGNIREKTYRAGRRKHDELLQQLDKAELNLFPEGVPQERLINIFYYL
fig|331678.4.peg.2223   Chlorobium phaeobacteroides BS1     RKELAELLIRQNRRF−−−−−−−GTAAKHLESIEKALSPRCMFVITGQQPGLFTGPLYSIYKALTAVIVAERQKAMFPEYDFIPLFWIEGEDHDFEESATTS−−IIDAGQIQQVSLDPWKRL−−PGQ−−−−MVSRSAMGPGIT−−DTLSDFTSML−−−−QESDYREQIVSMLQEIY−−−−−−−−−−−TPDSSLELAFGKTMAHLFKDYPLIFLSASDPDFKNLA−−KEIYYRELATCPHTSHTIIEQSSLLENM−−GYQTQVK−−PRAVNLFYVNHHD−−QRMKIEQ−−SSADSFSIV−−PDRHRYSRHQILEMCDDHPERFSPNVILRPVVQDHVLPTFAYIAGPGEISYMAQYRKTYEHFGLKMPFIIPRGSFTLIEPAVRRTMDKVLQKTGRLTQSRKQLYHTAF−−−HDLRILQKKAISGAENHDFD−−TLLDRTEKNILAELEALSPTLGKLDPN−−−−−−−LEQVLAGSLVQIEKVMTGIRQKTHRAGRRKHDELVAQLDKAAAGIFPEDLPQERVINIFYYL
fig|290512.6.peg.1960   Prosthecochloris aestuarii DSM 271     REALRDLLLRQNREY−−−−−−−GVAEEHLQLLEKIRSPRCMTIVTGQQPGLFTGPLYTIYKALSAVVIAERQKAMFPDYDFLPIFWIESDDHDFEESACTS−−LFRGSTRQEIILEPWNRL−−PGQ−−−−MVSRSPIGPSIR−−QCLDTLVESL−−−−HESDYREDIITKLNEFY−−−−−−−−−−−REETTLDGGFARTMAWLFRDYPLFFLSPGDPAFKKLS−−VEVFFRELSTCPEASHTVIAQSSRLEEK−−GYSAQAK−−PRTVNLFYINDHN−−QRQKIEQ−−VDRDFFALS−−PGKQRYSRHQILEMCGDHPERFSPNVILRAIVQDHVLPVFAYIGGPGEISYLAQYRRTYEHFGLKMPFIIPRGSFTLIEPVVSRIMDKVMQKSGRPSLSRKHMYQTAF−−−HDMAALQKNAIKGGDNHDYD−−ALFDRTAEALARELLALRPALVQLDPT−−−−−−−LEQSLMGTSKQAEKALDTLRQKTQRANRRKHDELLGQIDKSAMHLFPGGVPQERVVNIFYYL
fig|319225.3.peg.201   Pelodictyon luteolum DSM 273     RDSLVDMLQTQNRRF−−−−−−−GGGEVREREIEKLRSPRCMAVVTGQQLGLFTGPLYTIYKALSAVVFAERQKALFPEYDFVPVFWLEGEDHDYDEPAHTA−−IFSGSGLTHFRPETNRRL−−PDQ−−−−MVGSTCFDASIQ−−NTLEAFLDML−−−−PPSDYREEVATILRECY−−−−−−−−−−−FPGNTFEGAFASMLLRLMPKEPLILLSSFDPAFKRMA−−AGVFTREIETAPASSYNVVAQSSTLEEL−−GYGAQTK−−PRAVNLFHLNQHG−−QRQKIEH−−PSPDLFTLA−−GESRQYSRHQMLELVSDHPERFSPNVVLRPIVQDTVLPTFAYVAGPGEISYLAQYRRNYEHFGITMPFIVPRGSFTLVEPKISRIMDRMLQVTGRPGFSRKQIYAAVF−−−SDLEGMKKKAVETAENRSLE−−PLFQEAREEIQRALDRLLPTLSKIDPT−−−−−−−LEPMLGASKAQAEKIVENIEQKTWKAGRRKHEELLEQILKAETALFPEGGPQERLLNICYFL
fig|290318.6.peg.445   Chlorobium phaeovibrioides DSM 265     RDALVDMLLAQNRSY−−−−−−−GCTPLQEQEIEKLRSPRCMAVVTGQQLGLFTGPLYTIYKALTAIVFAERQKSLFPEYDFVPVFWLEGEDHDYDEAATTA−−LFRGNSVTKFRADTTLRE−−QDQ−−−−MTATTIFDSSIQ−−ETLNGFLEAL−−−−PESDFREEIAALLKGCY−−−−−−−−−−−RPGATVEHAFASTLMRLMHKQPLILLSSFDPAFKQLS−−AEIFAKEIDTAPATSYNVVAQSSKLEQL−−GYGAQTK−−PRAVNLFSLNHLG−−QRERIEK−−HSGETFTIA−−SGRQQFSKHQMLEAAQDHPERFSPNVVLRPIVQDFVLPTFAYIAGPGEISYLAQYRKNYEHFGITMPFIVPRGSFTLVEPKISRIMDRMLQVTGRPGFSRQQIYHAVF−−−SELEAMKTKVVAMAENRTIE−−PVFEQAKQEIQNALDALGPVLSKIDPT−−−−−−−LEGMLAASKAQAGKIVEGIEQKTWKAGRRKHDELLDQIQRAETALFPEGMPQERLINVFYYL
fig|290317.7.peg.2150   Chlorobium phaeobacteroides DSM 266     RATLVDLLKRQNQRY−−−−−−−GCSELHLKEIEKLRSPRCMVVVTGQQPGLFLGPLYTMYKALSAIVFAERQKALFPEYDFVPVFWMEIEDHDYEESAHTA−−LFSGGKVAHFRPEPYKRL−−PDQ−−−−MIGGSSFGEEMR−−NTVAEFIDTL−−−−QDSPHKEAISGLLNAAY−−−−−−−−−−−APGSTFETGFAQTMMHLFRDQPLILLSSQDREFKKLS−−RNIFARELATCPTASYNVIAQSSKLEKL−−GYTTQSK−−PRAVNLFYINTDN−−QRQKIEL−−HEEDTFQIH−−PDKQRYSRHQILELCEDHPERFSPNVVLRPIVQDTILPVFACIAGPGEISYLAQYRKNYEHFGITMPFIIPRGSFTLIEPKFSRIMDKLLRITGKPGFSRKQIYHAVF−−−NDLQTLKKNAEGIAEHPDIE−−RLFNETKTEMERLLESLEPVLAKIDPT−−−−−−−LAPVLAASSVQTLKIIESLEQKTRKAGRKKNEELLEQIQKSETAFFPEGVPQERMINSFYFI
fig|290315.5.peg.428   Chlorobium limicola DSM 245     RELLATILRRQNTRY−−−−−−−GCTELHLREIEKLRSPRCMTIVTGQQPGLFTGPLYTIYKALTAVVFAERQKTLFPEYDFVPLFWLEGEDHDYEESAHTA−−VFSAGGIMHFRPEPFRRM−−PDQ−−−−MVAATCFGEDIR−−RIVADFLDQL−−−−QETGNKPLIASMLGDCC−−−−−−−−−−−FPGNTLEMSFAQLMMHLFKNQPIVLLSSQDPDFKKLS−−RPVFLRELSTCPASSYNIIAQSSTLENL−−GYSAQSK−−PRAVNLFHINHHG−−QRQKIEY−−PEDNRFVIT−−PDNIHLSRHQILELCQDHPERFSPNVALRPIVQDTLLPSFACIAGPGEISYLAQFRRNYEQFGLTMPFVIPRGSFTLVEPKFSRFMDKMLRISGKSGFSRKQIYHAFF−−−SDLQTLKRNAERVGENPELD−−SLFFSIRDRIEKALKDLGPVLAKIDPT−−−−−−−LEPMLAASTLQAMKTVDTIEQKARKAGRRKNEELIEQILKTETAFFPEGVPQERLINVFYYL
fig|340177.8.peg.299   Chlorobium chlorochromatii CaD3     RESLVNMLLRQNSRF−−−−−−−GGGERQQQAIEKLRSPRCMAVVTGQQLGLFTGTLYTIYKALTAIIVAEQQKSLFPDYDFVPIFWLEGEDHDYDESASTT−−IFAENQLKHFTHQPYRRL−−PDQ−−−−TVANSSFSDDIR−−TIIDEMVALL−−−−PNTPHRTMVAEMLHECY−−−−−−−−−−−YPGCTFEISFASTMLRLFRNYPLILLSPQESDFKKLA−−MPIFFKEIESAPAVSYQVIAQSTRLESL−−GYSAQTK−−PRAVNFFYVNQHG−−QRQKVEQ−−PSSDTFQIV−−PEKQRLSRHQMLELCQDHPERFSPNVVLRPIVQDYVLPTFATIVGPGEINYMAQYRPIYEHFGITMPFLVPRGSFTLVEPKISRVMDKLIHVTGQPGFSRKNIYNAVF−−−SNLQQVKKNAIGEAEHPQLA−−TMFEQAKDEMRQALERLNHTLSTIDPT−−−−−−−LEPLLAASIVQSAKLVETIEQKTWKASRRKHEELLEQIQKAETALFPEGVPQERVVNIFYFI
fig|324925.4.peg.2541   Pelodictyon phaeoclathratiforme BU-1     RESLVRLLSRQNTRY−−−−−−−GATALHLREIEKLRSPRCMAIVTGQQLGLFTGPIYTIYKALTAIIFAKRQKALFPEYDFVPIFWLEGEDHDYDESAQTA−−IFSENQVVHFKEEPYRRL−−PNQ−−−−MVANSCFGEEIS−−RTVEEYLRLL−−−−PETTYKKEVSEMLREFY−−−−−−−−−−−YPGNTFEMSFACTMMRLFREQPLILLSSQDPDFKQLS−−SRIFLRELSSSPASSYNVVAQSSCLENL−−GYTAQTK−−PRTVNLFHVNHLG−−QRQKIEH−−PSEDSFSIL−−PDKQRYSKHQFLELCQDHPEQFSPNVVLRPIIQDFVLPTFACIAGPGEISYLAQYRKNYEHFGISMPFIIPRGSFTLVEPKISRIMDKLLQVIGKPGVSRKQIYHAVF−−−GDLQQLKKNAVGVTENPQLE−−TLFEETKTEIRRALAALGPLLSKIDPT−−−−−−−LEPLLAASTVQSAKIIENIEQKTWKASRRKHEELLEQILKAETALFPDGLPQERLINIFYFL
fig|377431.3.peg.236   Chlorobium ferrooxidans DSM 13031     RDTLAAMLTRQNTRF−−−−−−−GCNELHLREIEKLRSPRCMAIVTGQQLGLFTGPLYTIYKALTAIVFAERQKVLFPEYDFVPIFWLEGEDHDYEESAHTA−−LFSENRVTHFRQEPWRRM−−ADQ−−−−MVANSSFGEDIS−−RTVEEFLRLL−−−−PDSTHKERVTKILTECY−−−−−−−−−−−YPGNTFEMSFASTMMRLFSDHPLILLSTQDPDFKRLS−−ANIFLKELSTAPASSYNVVAQSSRLENL−−GYAAQTK−−PRSVNLYFLNSHG−−QRQKIEH−−GSDDSFSIT−−PDRQRYSKHQMLELCQDHPEQFSPNVVLRPIVQDYVLPTFATIAGPGEISYLAQYRKNYEHFGISMPFIIPRGSFTLVEPKISRIMDKLLQVTGKPGFSRKQIYNAVF−−−SDLQQLKKNAVGIAENPQLD−−ALFEQSKEEIRRTFAALRPILSKIDPT−−−−−−−LEPLLAASTVQSEKIVEVIEQKAWKASRRKHEELLEQILKAETSLFPEGVPQERLINIFYYL
fig|518766.7.peg.671   Rhodothermus marinus DSM 4252     RATLVEVLEEQNARW−−−−−−−GLDAATRRHIEALRDPECVAIVTGQQVGLLGGPLFTLYKALTVGKLARELADELDRPVVPVFWLAGEDHDYEEVASVT−−VLQGAEPVTLRLERPDPD−−YAG−−−−PVGRLALPETIR−−TLLDELADLL−−−−PPTEFQEPLLALLQETY−−−−−−−−−−−RPGVSFQDAFARLLKRLVPEEVGLVLIDPDDARLKALA−−RPLFERELTDWETAHARLEAVSRELGA−−−−RYHVQVQ−−TRPLHLFLLEDH−−−RRIPLDA−−EPDGFHLR−−GEDRVLSRAEALALLQKAPERFSPNALLRPLYQDWLLPTLAYVAGPAEIAYWAQLKPLYEWAGLPMPLVYPRALMLLVEPRIARWLERYQLRP−−−−−−−−−−−EALQ−−−EEPDRIFHRLVKEQLDGELE−−AAFEEARRQLRELGVRLRPLVERVDPS−−−−−−−LGPATEAWATGLEHELDRFWARVLKAGKRREETLRNQLVRARNSLFPNGVLQERVLSPVYFL
fig|309807.19.peg.2210   Salinibacter ruber DSM 13855     REVLADTLLDQNERW−−−−−−−GLDERTRSHIETLRDPDSIAVVTGQQVGLFTGPLYTIYKTITTLQLIEEWADQTGRPVVPVFWVEGEDHDFEEIAAAH−−VLQHNEVVPLSYEPGVDD−−NPG−−−−AVGRLALTDGIQ−−DVVDRLDEAL−−−−PPSDFKPAVMEQVRAAY−−−−−−−−−−−QPGTRLEDAFARLMRSLFEDDGLVFMNPDDARLKALT−−RPLFRRDIEDPRASVAPVNAAGRALRDR−−GYHAQVN−−AHPTNLFWLGDD−−−GRWAIDL−−EDENAFRLR−−GTDRTFSRSDLLNRLDETPERFSPNVVLRPLMQDHLLPTAAYVAGPGEVSYFAQYGGVYDWAGLDMPLIHPRASVSLVEGKVQKVLDKYGLTV−−−−−−−−−−−ADFR−−−DGLEPLFQDVVVDTMEVDVD−−ALFSEALPQLHQTLNALKPEVEAVDRT−−−−−−−LGASTEATRSAIMDEMEALKQKVVRAEKRQQDEVRAQLKKAHTNLRPDGTLQERTINVLYYL
fig|262724.1.peg.1195   Thermus thermophilus HB27      PRLREALAAYLKRL−−−−−−−QAPEEVFRALERL−−−EVGAVVTGQQAGLLGGPALTFYKAHTALCLADRAGA−−−−−−−AGVFWVASQDHDVEEVRHLH−−LLRDEVPETLSLDLPPLP−−−−−−−−−SGRIPLA−−−−−−−PHRERLRAFL−−−−GPWAKDYRLGYA−−−−−−−−−−−−−−−−LEAETLSEFFARVLLAFLGERGLVPFDPMAEELAPLF−−LEALERELSDPLGSAEAINREAERIRAL−−GGKPPLRRKPGATNLFLETD−−−−QRRLLFY−−EGGAFT−−−−DGVRRYTAKELWEIARADPSRLTPAAGLRPVFQDLVLPTAGFVVGPNELRYVAELSGVYARYGLAMPALFLRAFGVVVEPPVRRILEKYRLDP−−−−−−−−−−−WAFV−−−DEGEAAFLRAAEAWLAPF−−−−RAFRDRVEGLLQEASRLVEEAEALEPN−−−−−−−LVRPLRRFRARVRGEAERLRRKLLAAQAARDEVLARHLRRLKVHLLPFGLPQERVY      
fig|300852.3.peg.1878   Thermus thermophilus HB8      PRLREALAAYLKRL−−−−−−−QAPEEAFRALERL−−−EVGAVVTGQQAGLLGGPALTFYKAHTALCLADRAGA−−−−−−−AGVFWVASQDHDVEEVRHLH−−LLRDEVPETLSLDLPPLP−−−−−−−−−SGRIPLA−−−−−−−PHRERLRAFL−−−−GPWAKDYRLGYA−−−−−−−−−−−−−−−−LEAETLSEFFARVLLAFLGERGLVPFDPMAEELAPLF−−LEALERELSDPLGSAEAINREAERIRAL−−GGKPPLRRKPGATNLFLETD−−−−QRRLLFY−−EGGAFT−−−−DGVRRYTAKELWEIARADPSRLTPAAGLRPVFQDLVLPTAGFVVGPNELRYVAELSGVYARYGLAMPALFLRAFGVVVEPPVRRILEKYRLDP−−−−−−−−−−−WAFV−−−DEGEAAFLRAAEAWLAPF−−−−RAFRDRVEGLLQEASRLVEEAEALEPN−−−−−−−LVRPLRRFRARVGGEAERLRRKLLAAQAARDEVLARHLGRLKVHLLPFGLPQERVY      
fig|498848.5.peg.210   Thermus aquaticus Y51MC23           ALEAYLKRL−−−−−−−SAPKAVLEALAAL−−−KVGAVVTGQQAGLLGGPALTFYKAHTALGLAGRVGA−−−−−−−AGVFWVASQDHDVEEVRHLH−−LLLDEEVRTLSLPLPPLP−−−−−−−−−SGRIPLA−−−−−−−PYREALVAFL−−−−GPWAREERVAYA−−−−−−−−−−−−−−−−LEGQTLSEFFARVLLAFLGERGLIPFDPMAEELAPLF−−REALERELSDPLASAEAINQEAARIRAL−−GGKPPLGRKPGATNLFLETD−−−−ARRLLHY−−GEGSFT−−−−DGVRRYSKKELLEILQADPARLTPAAGLRPVLQDLVLPTAGFVVGPNEFRYVAELSRVYALYGLPMPALFLRIQGMVLEPPIRRILERYALDP−−−−−−−−−−−WAFV−−−DRGEEAFLEAARGALEGF−−−−REVESALAHLQKEVEALRERARALEPT−−−−−−−LDRPFRRFGARLKGEGERLLKKVLRARLAKDATLLHHLERLKRHLRPFGLPQERVYPFPMY 
fig|504728.4.peg.137   Meiothermus ruber DSM 1279     REALS