(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020557

fig|342451.4.peg.156   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305       TLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGG     
fig|342451.4.peg.144   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305       TLEQQLKHYITNLFNLPKDEVWHCESIEEIADDILPNQYVRLGPLSNKILQTNTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLTGG     
fig|904324.3.peg.1370   Staphylococcus epidermidis VCU065       TLEKQLKEYITNLFNLPKDEKWECESIEEVADNILPDQYIRLGPLTNKILHTYTYYSDTLHERHIYPFILYYQKQLIAIGYIDETNDMDFLYLHNTVMPLLDQRHLLEKENYNNE
fig|629742.3.peg.1605   Staphylococcus hominis SK119       TLSKQLKTYITERFKLNYQETWACETVDAVAEDVLPEKYIKNSPLEHKILNTFTYYNDELHEISIYPFLCYLDKELVAIGYLDNFDLDFIFLNDTHQIIIDERYLLQKGGE   
fig|525374.3.peg.809   Staphylococcus epidermidis BCM-HMP0060       TLSKQLKTYITERFKLNYQKTWACETVDAVAEDVLPEKYIKNSPLEHKILNTFTYYNDELHEISIYPFLCYLDKELVAIGYLDNFDLDFIFLNDTHQVIIDERYLLQKGGE   
fig|279808.3.peg.70   Staphylococcus haemolyticus JCSC1435       TLSKQLKTYITERFKLNYQDTWSCETVDAVAEDVLPEKYIKNSPLEHKILNTFTYYNDELHEISIYPFLCYLDKELIAIGYLDNFDLDFIFLNDTHQIIIDERYLLQKGGE   
fig|451515.3.peg.84   Staphylococcus aureus subsp. aureus USA300_FPR3757     MKTITQELKQYITHLFQLSNNEAWECEALEEAAENILPERFINDSPLVHLTLETYTYYNDELHELSIYPFLMYANNQLISVGYLDHFDMDFLYLTDTQNIIIDERHLLKQGGQDHE
fig|525374.3.peg.788   Staphylococcus epidermidis BCM-HMP0060     MKTITQELKQYITHLFQLSNNEAWECEALEEAAENILPERFINDSPLVHLTLETYTYYNDELHELSIYPFLMYANNQLISVGYLDHFDMDFLYLTDTQNIIIDERHLLKQGGQDHE
fig|176280.1.peg.33   Staphylococcus epidermidis ATCC 12228     MKTITQELKQYMTHLFQLSNNEAWECEALEEAAENILPERFINDSPLVQLTLETYTYYNDELHELSIYPFLMYANNQLISIGYLDHFDMDFLYLTDTQNIIIDERHLLKQGGQDHE
fig|176280.1.peg.55   Staphylococcus epidermidis ATCC 12228     MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPERFINNSLLAHLTLNTYTYYNDELHELSIYPFLMYANDQLISIGYLDHFDMDFLYLTDTKNTLIDERHLLKQGGNHHE
fig|904324.3.peg.689   Staphylococcus epidermidis VCU065     MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPERFINNSLLAHLTLNTYTYYNDELHELSIYPFLMYANDQLISIGYLDHFDMDFLYLTDTKNTLIDERHLLKQGGNHHE
fig|1157029.3.peg.3   Staphylococcus aureus M0427     MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPERFINDSPLAHLTLETYTYYNNELHDLSIYPFLMYANNQLISVGYLNHFDMDFLYLTDTKNTIIDERHLLREGGTHHE
fig|585891.3.peg.56   Staphylococcus aureus subsp. aureus Mu50-omega     MKTTTQELKQYITRLFQLSNIETWECEALEEAAENILPERFINDSPLAHLTLETYTYYNNELHDLSIYPFLMYANNQLISVGYLNHFDMDFLYLTDTKNTIIDERHLLREGGTHHE
fig|451515.3.peg.109   Staphylococcus aureus subsp. aureus USA300_FPR3757     MKTTTQELKQYMTRLFQLSNNETWECETLEEAAENILPKRFINDSPLAHLILETYTYYNNELHELSIYPFLMYSNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGNNHE
fig|904772.3.peg.1588   Staphylococcus aureus subsp. aureus 21342     MKTTTQELKQYITRLFQLSNNETWECEALEDAAENILPTRFVEHSPLAHLTLETYTYYNDELHELSIYPFLMYTNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGNNHE
fig|553212.3.peg.1131   Staphylococcus capitis SK14     MKTITQELKQYITRLFQLSNNETWECEALEDAAENILPTRFVDHTPLAHLTLETYTYYNDELHELSIYPFLMYANNQLISIGYLDHFDMDFLYLTDTKNTLIDERHLLKEGGNCHE
fig|282459.5.peg.32   Staphylococcus aureus subsp. aureus MSSA476     MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLETYTYYNDELHELSIYPFLMYANNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLQKGGE   
fig|1075078.3.peg.36   Staphylococcus aureus ST228/15532     MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLDTYTYYNDELHELSIYPFLMYTNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGTRHE