(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009527

fig|203120.7.peg.64   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293           YQIYWTPNTELLGLQGATVDFRSLNEVYYENYFLPSGEVVARWHSTYNRMSGQPVVKADLPQLSHGETYVIERHIDASDRMFAYLVVTFFDQQYQPIATFSENTERLLINTPDEYAFYVIDLVSAGSGHFTFHNFDIRIKRAGILREDDQEIAPQLYNYLHQPEKVTSKVLRVIFSEPEEAVTDYVTKKIKTTQQAVLFVASGTLKAGYYRQLE−−LISGIKTARKQAKAHSLEFVGYGPISSYAALYYQQQI−−−−−−−−KKSV−−−−−−−−−−AIISEDILLSPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSEWTIE
fig|586220.3.peg.1577   Leuconostoc mesenteroides subsp. cremoris ATCC 19254           YQIYWTPNTELLGLQGATVDFRSLNEVYYENYFLPSGEVVARWQSTYNRMSGQPVVKADLPQLSHGETYVIERHIDASDRMFAYLVVTFFDQQYQPIATFSENTERLLINTPDKYAFYVIDLVSAGSGHFTFHNFDIRIKRAGILREDDQEIAPQLYNYLHQPEKVTSKVLRVIFSEPEEAVTDYVTKKIKTTQQAVLFVASGTLKAGYYRQLE−−LISAIKTARKQARAHSLEFVGYGPISSYAALYYQQQI−−−−−−−−KKSV−−−−−−−−−−AIISEDILLSPG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSEWTIE
fig|349519.10.peg.1831   Leuconostoc citreum KM20           YQVYWTPQTQLLELQGATVDFRARDDVYYENYFLPSGRTIVSWQSQHSSQNQRL−−ADLPQLLRGETYAFIKHIDNSERMFAYLTVTFYDDQYQTLMTTSQNKDEVVVKVPDNYAFYTIDLVSAGLGSFIFHNIAIRPQKKGILRDDDQRIAPNLYSYIEIPAKITSKTLRVIFSEPEDQVTDYMADWVKETQQAVQYIASSAINARYYRQDEQAVTMAIKQARKQVHARRVEFIGYGPISSYAALYYQSQF−−−−−−−−KGSL−−−−−−−−−−ATISEDVNLVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDLRLERAVTGVNYLSNPIAPNYTLAVQ
fig|979982.3.peg.1839   Leuconostoc sp. C2           YKIYWTPQTQLRQLQGATVDFQALDHVTYEHYFLPSGQVIATWHSRHLYQGEKRI−−SDLPQLLRGETYVIERRIDASERMFAYLIVTFFDDQYQSLETNSQNTDKITVTVPEDYAFYTIDLVSAGNGQFVFHDFVIRQKKAGILRDNDTEIAPKLYTAVEMPAKITAKTLRVVFSEPESGTIDYMSEWIKETQQAVQYIASSEVNAGYYRHHEDVLVASVKLTRKQAHARQIEFVGYGPISSYAALYYQSQF                                                                                             
fig|1154913.3.peg.1798   Streptococcus agalactiae GB00264     M−−STISYIYWDDFSRFSYNFGTKLQFLGKSVCFENPLAPSSTNLYTWSSQTNYQSKRIS−−PNLPLLRKGTRYSLSLNAELDLVSSLFVRIEFYNRFNESVGFELLKKDSIIFIYPKEAYTYTISLINAGCSDFTFHYLKLEE−−−−VTDSVIQEKNLSTEFTIEEHQ−−−DVLNLLLVEKKDSVYINKIESISQLQQKVELVSNPSLNSDSLILPE−−LEKGLEDALKVFPNIKINVIAYGTQGNFAALYYAKKFPRITAYINDCFAPFGILLKSLPHLTAKQQIFLREVWDTRET−−−−−−−SPNVKHYGLVSENSSLNLVSMILSGNEHLPYLTLLKKQDDNYDSL
fig|1105231.3.peg.2061   Streptococcus agalactiae BSU260     M−−STISYIYWDDFSRFSYNFGTKLQFLGKSVCFENPLAPSSTNLYTWSSQTNYQSKRIS−−PNLPLLRKGTRYSLSLNAELDLVSSLFVRIEFYNRFNESVGFELLKKDSIIFIYPKEAYTYTISLINAGCSDFTFHYLKLEE−−−−VTDSVIQEKNLSTEFTIEEHQ−−−DVLNLLLVEKKDSVYINKIESISQLQQKVELVSNPSLNSDSLILPK−−LEKGLEDALKVFPNIKINVIAYGTQGNFAALYYAKKFPRITAYINDCFAPFGILLKSLPHLTAKQQIFLREVWDTRET−−−−−−−SPNVKHYGLVSENSSLNLVSMILSGNEHLPYLTLLKKQDDNYDSL
fig|205921.4.peg.1433   Streptococcus agalactiae A909     M−−STISYIYWDDFSRFSYNFGTKLQFLGKSVCFENPLAPSSTNLYTWSSQTNYQSKRIS−−PNLPLLRKGTRYSLSLNAELDLVGSLFVRIEFYNRFNESIGFELLKKDSIIFIYPKEAYTYTISLINAGCSDFTFHYLKLEE−−−−VTDSVIQEKNLSTEFTIEEHQ−−−DVFNLLLVEKKDSVYINKIESISQLQQKVELVSNPSLNSDSLILPE−−LEKGLEDALKVFPNIKINVIAYGTQGNFAALYYAKKFPRITAYINDCFAPFGILLKSLPHLTAKQQIFLREVWDTRET−−−−−−−SPNVKHYGLVSENSSLNLVSMILSGNEHLPYLTLLKKQDDNYDSL
fig|1158505.3.peg.892   Staphylococcus aureus M1565     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIDDNQYGNDRINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDDIKENIKQ−−LKDDLQ−−−SQDTLTAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWLTEHVPGNNELKDTNVEFYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|931459.3.peg.465   Staphylococcus aureus subsp. aureus CIGC128     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLVFRCLTITE−−−−MTHQDDLEYKSMRVTKIDDNQYGNDKINVIIAEPSDVYPTISNDFLKLFGHVWLVERWMEDDIKENIKQ−−LKDDLQ−−−SQDTLTAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWLKEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|1231383.3.peg.886   Staphylococcus aureus KT/314250                                                       MLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLVFRCLTITE−−−−MTHQDDLEYKSMRVTKIDDNQYGNDKINVIIAEPSDVYPTISNDFLKLFGHVWLVERWMEDDIKENIKQ−−LKDDLQ−−−SQDTLTAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWLKEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|450394.6.peg.1656   Staphylococcus aureus subsp. aureus USA300_TCH959     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIDDNQYGNDMINVIIAEPSDVYPTISNDFLKPFGHVWLVERWMEDDIKENIKQ−−LKDDLQ−−−SQDTLTAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWLKEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|548474.3.peg.221   Staphylococcus aureus subsp. aureus TCH130     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLVFRCLTITE−−−−MTHQDDLEYKSMRVTKIDDNQYGNDKINVIIAEPSDVYSIISNDFLKPFGHVWLVERWMEDDIKENIKQ−−LKDDLQ−−−SQDTLTAINLISYGSKSNVFETYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWLKEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|1158530.3.peg.486   Staphylococcus aureus M0424     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQYDLEYKSMRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−GCKV−−−−−−−−−−YRTSHEDDDLKGWLTEHVPGNHELKDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|426430.8.peg.2762   Staphylococcus aureus subsp. aureus str. Newman     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQYDLEYKSMRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFVTYVAQHL−−−−−−−−GCKV−−−−−−−−−−YRTSHEDDDLKGWLTEHVPGNHELKDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|1323661.3.peg.2642   Staphylococcus aureus CA-347     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIGDDQYGNDRVNVIIAEPSDTYPTISNDFLKSFGHVWLVERWMDDNIEENIKQ−−LKNDLQ−−−SQDTLTAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWFTEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|585160.3.peg.2477   Staphylococcus aureus subsp. aureus WBG10049     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIINFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDNLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKSFGHVWLVERWMDDNIEGNIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWFTEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|1137131.3.peg.416   Staphylococcus aureus subsp. aureus 122051     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSQYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIINFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDNLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKSFGHVWLVERWMDDNIEGNIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWFTEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|1169271.3.peg.498   Staphylococcus aureus M1256     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDNLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKSFGHVWLVERWMDDNIEGNIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKEWFTEHVPGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|273036.3.peg.2452   Staphylococcus aureus RF122     MLKNKTFKVTWDYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRGGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKPFGHVWLVERWMDDNIEENIKQ−−LKNDLQ−−−SQDTIKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKDWFKEHVPGNHELKDTNVDVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
fig|904772.3.peg.1378   Staphylococcus aureus subsp. aureus 21342     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGAKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKPFGHVWLVERWMDDNIEENIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKDWFKEHVLGNHELKDTNVEVYFKEEQDNHLNYMSR                        
fig|585152.3.peg.2649   Staphylococcus aureus subsp. aureus D139     MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA−−PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITE−−−−MTHQDDLEYKSMRVTKIGDDQYGNDRINVIIAEPSDAYPTISNDFLKPFGHVWLVERWMDDNIEENIKQ−−LKNDLQ−−−SQDTLKAINLISYGSKSNVFATYVAQHL−−−−−−−−DCKV−−−−−−−−−−YRTSHEDDDLKDWFKEHVLGNHELKDTNVEVYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET