(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00007666

fig|342451.4.peg.2450   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     NNLSNKTRLNHQFKFSTMALIISTSLMGYSMTSTPSVEAKDKADLNIETHSNSENTLEKRIQEGKEKIDKLKNIKDSQKDASIKEITKAKSTEEVEAILKKAKKVDN−−−−−−KII−−−−−−−−−−EQNRVQSHLIEND−−−−KKEVSEDKKSVKSELDSKKNIVSSVKEKSNHIEEQD−−−−−−−−−−−−−−−−−SIDLFDQEDLQDNTFDANL−−−−−−−−−NQRDTKQDISHLVD−−MGKLNEESKDIADM−−−−−−−−−−−−−−−−−−−−−NDSEENKNTASEKDEGAVKENNQDG−−−−−−−−−−−−−−−−−LAFKDTSN−−−−−−−−TKSNQMQQSDEIKKDIDKVTTNHSKVKDNLDYYVENKENNLKILDSKLSERDSISAKNKEKLKKEIEKTQQSLKKQNDVVLNHLQSVNNKEQAVKDIVSGTFDEKSAQSILERIDTKGKTDQQIASQVVSELDNLSTTTSDDILKSMFDKTSDKQELIKTILLTKFDHIDTSKIVDEIMHKNPSNEQIVALIKHHFGDN−−VTSDDILENILDQSHDKRKALETMLATKLNDAKAKALADVIAKKEDSKHNLLNLMKSGINNELNDLLKADKDISKFKDDMHGLFEPLKYTPSLSNKFDGSLLDRAEQMRKL−−−−−−−−−−−−−SGNSKLLGTPSLFDDLFNRNSILDGIKDISNPSPGRALSLGD−−SSGSFLSGLFDNNGDFSLPDTGTVVKKSTIPLGILLFIIGGGLIWFIKRNKSKNCK
fig|342451.11.peg.2434   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305                                   MTSTPSVEAKDKADLNIETHSNSENTLEKRIQEGKEKIDKLKNIKDSQKDASIKEITKAKSTEEVEAILKKAKKVDN−−−−−−KII−−−−−−−−−−EQNRVQSHLIEND−−−−KKEVSEDKKSVKSELDSKKNIVSSVKEKSNHIEEQD−−−−−−−−−−−−−−−−−SIDLFDQEDLQDNTFDANL−−−−−−−−−NQRDTKQDISHLVD−−MGKLNEESKDIADM−−−−−−−−−−−−−−−−−−−−−NDSEENKNTASEKDEGAVKENNQDG−−−−−−−−−−−−−−−−−LAFKDTSN−−−−−−−−TKSNQMQQSDEIKKDIDKVTTNHSKVKDNLDYYVENKENNLKILDSKLSERDSISAKNKEKLKKEIEKTQQSLKKQNDVVLNHLQSVNNKEQAVKDIVSGTFDEKSAQSILERIDTKGKTDQQIASQVVSELDNLSTTTSDDILKSMFDKTSDKQELIKTILLTKFDHIDTSKIVDEIMHKNPSNEQIVALIKHHFGDN−−VTSDDILENILDQSHDKRKALETMLATKLNDAKAKALADVIAKKEDSKHNLLNLMKSGINNELNDLLKADKDISKFKDDMHGLFEPLKYTPSLSNKFDGSLLDRAEQMRKL−−−−−−−−−−−−−SGNSKLLGTPSLFDDLFNRNSILDGIKDISNPSPGRALSLGD−−SSGSFLSGLFDNNGDFSLPDTGTVVKKSTIPLGILLFIIGGGLIWFIKRNKSKNCK
fig|396513.4.peg.2435   Staphylococcus carnosus subsp. carnosus TM300     YDLNYKNKLSRQFKISSAILVITSSLIGSNIVLSPSLDAEETPNLNKEQSSEKTHQLQEYIQKSREQLNRIQGLETNQKEKINEQIGKAQNFKEIDNLLKEAKNDTL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSNVDKAKIKDELEQQEPDKLKTKESAENLSEKS−−−−−−−−−−−−−−−−−−EALPTKPNAPEKPIKQSL−−−−−−−−−ENEQSNQEVEEFVK−−−−KIENISKEVDES−−−−−−−−−−−−−−−−−−−QLKEKETLTNEESSNNKVTEQANQTKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIKDLKDEVDNLAKQSENLNSDLNQYVQDKEKNLDLLASKVSERDTISKENKARIEKKIEESKRDLKQRNDIVFNRLESTADKKQAVKDIIGDNLNDKETQNILKHIDTKGKTDQQITSQVVGELDKLSSFSSDGLLESMFAKADNRKELIEVLLSTKFDEQEAKAIAKKIMQNNPDNARIVELLKQHYGEN−−ISGDDILENVLDRADNKQKAIETILASKLSDNKARLLANKIADKGNSKVELLKLMKSDADSRINQLLKTDNEVEQMKSKLHGIFNPLNSTFGLLDQLSNKQSKPD−−−−LL−−−−−−−−−−−−−SGHSNLFGSSSLLDKLLNGKNLLDGIPDIPNPSQGRALSLGD−−SSDDFLSGLFDYEGNFDLPKAGEAAKKVALPFGASMIIMGGGIVWYVKHRKRKTKS
fig|883164.3.peg.1641   Staphylococcus lugdunensis ACS-027-V-Sch2     KSSQGRQPFGTYIKLSCSALLISSVFVNYSSIENVHAETAEN−−−−−QSIDENHHKISQWISDAKQDINELNALNDSVRKQFEKQLDEATSRQEIKQIVADATDENQ−−−−−−−−−−−−−−−−−−−AREDGSEADNTSSQDTKHSAQSTTTTDITAELDKILADLNAVVDKDITDTPK−−−−−−−−ASEAQRGTKDNEQYDSSKVQDK−−−−−−−−−−−−−−−−ERQNDQKSTTVLD−−−−DLAHIKDHVKQADSAVTKDDKEQTEPNNKETKSNQQQTPTVKSHEKNEDQLKPQHRDANHSTRA−−−−−DKAIDSAASKQNTN−−STHLMEKLDKQLTPTEKIEAA−−−VTKVQNDNHHNNKDYADKRLNQLATLKENVTNRVDIAQDKKKQIITDIERAANKTTANRQIIQNDLAQAEDKEAVVKDIVTTIFSPNEAQQILKNMSVKGKTDKEIADQLLQHIDKLALTSSDDILASMFDQTKDKSHLIETILGMKLSPEEAKKAAQRLTNAKLSNKALVQQLKKEFGLNGKANADDILQSILDQSTNQKEAIKTILATKINEEKARLLADVISRVSKDKKDVLQLVKSALNGKADDLLQLKHRLDQAQHQADDILAPIKNRPSLLDRLHADAQRHR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVLDQIDDI−−PNPTQGLSLGHINNQDNFLSGLFDDNGSLSLPASGQVLKTYWPVLAIGMILIGGGLLLLARTRKQHNAK
fig|629742.3.peg.1383   Staphylococcus hominis SK119     NKNRKMSKLSSYLKVSCSALILSSSLVGYGFTKDAFAATQDAETATSETTTHVQKDLQDAMNKAKKDIKQLKHLSAVELKSYKEDIESAKNQNEIKDIIKEAKKENKVTAQENTTDVSNKDNSTESSSTQDASTEEEEKATTSNDTSADNTSNISNELDNIVSDLDTLSNKVDSGQQKD−−ATTSNESSSSESNTSENTTDEVTKEEPTTEESPKEVPTTEKPSNQTTSSKSETSIVD−−−−KLDSIKNDIDSAKKDIESSKENDSNQLPSDENSTEEETTESSSIQDAPTTENTTHSNSNHHILDGLAKLN−−−DTHKDQDLDTDARHHQFDKVNHQLSETEKINQA−−−IAKIENSKDDASHLYINRKLDQLSDLRDNIQHQADLAKKDKQAIDNDIETVRKNIENNRDIILNRLQQVSDKQRAAEDVLNSVFSKNEAQHILKNIKTKGQSDKQIADQIMKQIDGLTSTTSDDILKSMLEQATNKEDLLKTILSTRLGQNEAATIAKRLANDHLTNSQIVDRLKQAFNQHGLVSSDDILNDILDKTSNRKQAIETMLATKLNQAKANALADIISRVQSDKANALDLVKSTINGKANDLLQLQNSLGQAKNRLNYILDPIVNRPSLLDRITGNTSGSNLGSNLLGNGLDLLGGLTGSHLLGNLPSGSSLLDGLTNGNSLLDGISDI−−PNPTQGLSLGHLGDDGLLSGLFNSDGNLSLPATGEAIKKNWIPIAAVIAITGGALVWFSRRKHHQSNN
fig|279808.3.peg.425   Staphylococcus haemolyticus JCSC1435                               MGYGFTKDGFAQSNDRIDNVSSEMTSVQNKLDKAIDKAKAKIDRLKYLQATDIKSYKEDIEDARNQSEIDQILRDAQEEDRISNEESTKETGEKASTSNESSLSTAKQSSTNE−−−−−−−−−−−−ENKLDELDKVIADLDSLSEKVDTHQQNG−−−−−−−DMKSEQDSTNNNENSQISSGQSASSQNNK−−−−−−−−−NQINDKNDDTSILD−−−−EMDNVKNDIESTKESAHSSVEDIR−−−−−−−−−DQTDSSIQDDNSTESQSKNNTNTASDKSILSGIKQIDKDEDSHKSNKIDS−−KEGHVDALTDELSANQKIDQA−−−ITKVENQQDNTSKRYSDHKLEQLRQLEQQVKQNNNLTNEQKQNVEKDIKIVRQNVKANRDEISGRLEQSSNKQATVEQILGSVFSKNEAQKIAKKIKTNGQSDKQITDQMMKHIDNLKTTTSDDILASMFDQAPDKEALIKTLLSTRLGNNEASQIAKQLAKENLSSSELVNQVKQKINANQKITADDILKDVLDKSSDPKQTIETLLATKLNQTQAKALADLIARAQNDKANALDLVKNALNGTASDLLQLQNKLDTAKNNLSYILDPITNRPSLFDRINGSASSSNSLNQGS−−−−−−−−−−−−−HLLDGLTGSSLLDGLNSGGSLLDNIEDI−−PNPVQGLSLGQLGDDDGFLSGLFDDEGNLSLPNTGEVVKKSWLPVTVLLVIAGGTLIGLGRRKQQKTKQ
fig|279808.8.peg.349   Staphylococcus haemolyticus JCSC1435     KKLRQHSKFNSYLKVSCSVLLMSGTLVGYGFTKDGFAQSNDRIDNVSSEMTSVQNKLDKAIDKAKAKIDRLKYLQATDIKSYKEDIEDARNQSEIDQILRDAQEEDRISNEESTKETGEKASTSNESSLSTAKQSSTNE−−−−−−−−−−−−ENKLDELDKVIADLDSLSEKVDTHQQNG−−−−−−−DMKSEQDSTNNNENSQISSGQSASSQNNK−−−−−−−−−NQINDKNDDTSILD−−−−EMDNVKNDIESTKESAHSSVEDIR−−−−−−−−−DQTDSSIQDDNSTESQSKNNTNTASDKSILSGIKQIDKDEDSHKSNKIDS−−KEGHVDALTDELSANQKIDQA−−−ITKVENQQDNTSKRYSDHKLEQLRQLEQQVKQNNNLTNEQKQNVEKDIKIVRQNVKANRDEISGRLEQSSNKQATVEQILGSVFSKNEAQKIAKKIKTNGQSDKQITDQMMKHIDNLKTTTSDDILASMFDQAPDKEALIKTLLSTRLGNNEASQIAKQLAKENLSSSELVNQVKQKINANQKITADDILKDVLDKSSDPKQTIETLLATKLNQTQAKALADLIARAQNDKANALDLVKNALNGTASDLLQLQNKLDTAKNNLSYILDPITNRPSLFDRINGSASSSNSLNQGS−−−−−−−−−−−−−HLLDGLTGSSLLDGLNSGGSLLDNIEDI−−PNPVQGLSLGQLGDDDGFLSGLFDDEGNLSLPNTGEVVKKSWLPVTVLLVIAGGTLIGLGRRKQQKTKQ
fig|904334.4.peg.838   Staphylococcus capitis VCU116      KRTRVHQLSGYLKISCTALLVSGTIIGYGFTHNTHADSTETSRTMTQAQDQNHSLSKHIKEAKDKLNHLKDLSKEDIKDYQTRIDRAKDDSKIDAIIEDARQHNE−−−−−−KL−−−−−−−−−−−−VNSTVSNDSNND−−−−−−−−−−−−SKASKELDQFLEDLDAISNNVDNYQPNNGVNEDHPNKD−−−AIHKEDTQNTEAKDN−−−−−−−−−−−−−−−−−−DTKAQANDTTIFK−−−−KLDSIKDDVDSLRS−−−−−−−−−−−−−−−−−−−NESSSTSQSDKKTSNQSDN−−−−−KER−−QNQIEHDIATLKSEANQNRDN−−AEDTIGKITKDLQGSDKITHA−−−LAQRQSRQNDNNENYLSRKLNDLGALESKVKEDNHLSDDNKQKLKREIDRAHQKLDGQQNAILNQLKNDKDKAKTTANILHSIMSNNEAQRALKHIKIKGQSDKDIANQIAKQIDGVATTSSDDILKSMLDQSHNKEKLIKELLSTRLGNNEASQIAKKLANGHLSQSQIVEQLKRYFDKNGHATADDILNGVLNNAKNKKEAIETILATRLNQDKAKILASVITRIQNDKTDALQLIQSALNGKANDLLQLQNRVKRAKGDLNYILSPIKDRPSLLDRIHGNHHNSSQLADIL−−−−−−−−−−−−−NQLAGLTNGSGILDGLNSKDSILDGIGNMDTPSPENNLSLGS−−−GDGLLSGILNDDGNISLPAAGKVLKLSVLPFAIIALVIGSTLIWVSRRKKHHAS 
fig|525378.3.peg.1632   Staphylococcus epidermidis M23864:W1      KQTRKHQFGVYVKMSCSVLLMSGTLIGYGLTKDTQADSTETPT−−−HHYQSPNESLSHRIEQAKKDLNQLKSLTKEDLDNYQTRIDKAKDKSNIDEIIEDAKQRNN−−−−−−QLE−−−−−−−−−−SSNPSATDDKNTD−−−−−−−−−−−−SETTKELDQFLTELNDISDKVDNPQQNSVADTHKNEEDGRSNHSENANDSIADDGDLSEKTQK−−−−−−−−−−NTDDNADDQTIFS−−−−KLDKIKEDVNSADS−−−−−−−−−−−−−−−−−−−EDQSTSKNTEHKPSNDSKNVSTEDKDH−−LEKAHSDIDNLKSSINDETPN−−VDEKIGTITEHLKGSDKITHA−−−LAKAQAQHNDINNYLNQKQTNLNALKKKVDENQKLPERNKEKLNNEIKKAQQKLNGQQNIILDQLKNSKDKAQATKNILNSVMSKNEADNAMKQIKTSKQSDKQIANQIAKQMDSLATTSSDDILKSMLDQSKDKEKLIKQLMSTRLGQNEASKIAKKLAHSHLSNAQIVNQLKRDFDKKGNATSDDILNGVLNNAKNKKEAIETILATRLNQEKAKMLAEVISRIQNDKSDALKLIQSALNGKVNDLLQLQKQVHKAKNDLDYILSPIKDRPSLLDRIHGNKHHNGQLADLL−−−−−−−−−−−−−NQISDLTKGPSLFDRLNSKGSLLDGVNNIDTPTPENGLSLGS−−−GDSLLSGLFNDDGNISLPATGKIVKRSALPIAIVALIVGIMFIWKSRRKHKHTK 
fig|525376.3.peg.1696   Staphylococcus epidermidis W23144            KIGVYLKLSCSALLLSGSLVGYGFTKDAFADSESTSSN−−VENTSNSNSIADKIQQAKNDIKDLKELSDADIKSFEERLDKVDNQSSIDRIINDAKDKNN−−−−−−HLE−−−−−−−−−−STDSSATSSKTED−−−−DDTSEKDNDDITKDLDKILSDLDSIAKNVDNRQQDE−−−−−−GSVSKPSDSTTDEEDDSNNKVHDTSASTR−−−−−−−−−−−NATTDDSEESVID−−−−KLDKIQQDFKSDSNNKPSEQSNQQASSSNKTENNKEESSTTTNQSDSDSKDDKSNDGRRSTLERLASDTDQIRDSKNQHVTD−−GKQDIQAITRSLQGSDKIEKA−−−LAKVQTDNQSLDSNYINNKLMNLRALDTKVEDNNTLSDDKKQALKKEIDKTKQSIDRQRNIIIDQLNGASNKKQATEDILNSVFSKNEVEDIMKRIKTNGRSNEDIANQIAKQIDGLALTSSDDILKSMLDQSKDKESLIKQLLTTRLGNDEADRIAKKLLSQNLSNSQIVEQLKRHFNSQGTATADDILNGVINDAKDKRQAIETILQTRINKDKAKIIADVIARVQKDKSDIMDLIHSAIEGKANDLLDLEKRAKQAKKDLEYILDPIKNRPSLLDRINKGVGDSNSIFD−−−−−−−−−−−−−−−−−−−−−−−RPSLLDKLHSRGSILDK−−−LDHSAPENGLSLDN−−−KGGLLSDLFDDDGNISLPATGEVIKQHWMPVAVVLMSLGGALIFMARRKKHQN  
fig|525374.3.peg.275   Staphylococcus epidermidis BCM-HMP0060            KIGVYLKLSCSALLLSGSLVGYGFTKDAFADSESTSSN−−VENTSNSNSIADKIQQAKDDIKDLKELSDADIKSFEERLDKVDNQSSIDRIINDAKDKNN−−−−−−HLK−−−−−−−−−−STDSSATSSKTED−−−−DDTSEKDNDDMTKDLDKILSDLDSIAKNVDNRQQGE−−−−−−NSASKPSDSTTDEKDDSNNKVHDTNASTR−−−−−−−−−−−NATTDDSEESVID−−−−KLDKIQQDFKSDSNNKLSEQSDQQASPSNKNENNKEESSTTTNQSDSDSKDDKSNDGRRSTLERIASDTDQIRDSKDQHVTD−−EKQDIQAITRSLQGSDKIEKA−−−LAKVQSDNQSLDSNYINNKLMNLRSLDTKVEDNNTLSDDKKQALKQEIDKTKQSIDRQRNIIIDQLNGASNKKQATEDILNSVFSKNEVEDIMKRIKTNGRSNEDIANQIAKQIDGLALTSSDDILKSMLDQSKDKESLIKQLLTTRLGNDEADRIAKKLLSQNLSNSQIVEQLKRHFNSQGTATADDILNGVINDAKDKRQAIETILQTRINKDKAKIIADVIARVQKDKSDIMDLIHSAIEGKANDLLDIEKRAKQAKKDLEYILDPIKNRPSLLDRINKGVGDSNSIFD−−−−−−−−−−−−−−−−−−−−−−−RPSLLDKLHSRGSILDK−−−LDHSAPENGLSLDN−−−KGGLLSDLFDDDGNISLPATGEVIKQHWIPVAVVLMSLGGALIFMARRKKHQN  
fig|176279.9.peg.2202   Staphylococcus epidermidis RP62A            KIGVYLKLSCSALLLSGSLVGYGFTKDAFADSESTSSN−−VENTSNSNSIADKIQQAKDDIKDLKELSDADIKSFEERLDKVDNQSSIDRIINDAKDKNN−−−−−−HLK−−−−−−−−−−STDSSATSSKTED−−−−DDTSEKDNDDMTKDLDKILSDLDSIAKNVDNRQQGE−−−−−−ERASKPSDSTTDEKDDSNNKVHDTNASTR−−−−−−−−−−−NATTDDSEESVID−−−−KLDKIQQDFKSDSNNNPSEQSDQQASPSNKTENNKEESSTTTNQSDSDSKDDKSNDGHRSTLERIASDTDQIRDSKDQHVTD−−EKQDIQAITRSLQGSDKIEKA−−−LAKVQSDNQSLDSNYINNKLMNLRSLDTKVEDNNTLSDDKKQALKQEIDKTKQSIDRQRNIIIDQLNGASNKKQATEDILNSVFSKNEVEDIMKRIKTNGRSNEDIANQIAKQIDGLALTSSDDILKSMLDQSKDKESLIKQLLTTRLGNDEADRIAKKLLSQNLSNSQIVEQLKRHFNSQGTATADDILNGVINDAKDKRQAIETILQTRINKDKAKIIADVIARVQKDKSDIMDLIHSAIEGKANDLLDIEKRAKQAKKDLEYILDPIKNRPSLLDRINKGVGDSNSIFD−−−−−−−−−−−−−−−−−−−−−−−RPSLLDKLHSRGSILDK−−−LDHSAPENGLSLDN−−−KGGLLSDLFDDDGNISLPATGEVIKQHWIPVAVVLMSLGGALIFMARRKKHQN  
fig|596319.3.peg.1941   Staphylococcus warneri L37603            KVSMCLKLSCSALLISGSMIGYGFASDMTAQAKETSSSFHTSESKDESLKDKIDDAKDDIDRLTHLKEDSRQDYHKQLDDVSDNATLDKIIEDAKKEDR−−−−−−KLKLLDKETHQTTNSDKNASTEKNNE−−−−NVKDTKDNDDVTKDLDKILADLDVSSEKVDNPQQKS−−−−−−−−−−−−−−−GETNQVQSQSNVRDT−−−−−−−−−−−−−−−−QQTSNRNQTSVLD−−−−DLDKIKQDTTLDEDVNVTNTQKDFNRASNQRQDAQQDSKDQSQE−−TTKKLPQTNIKEQQTLD−−−−DIKHIANEADVKQSDHKQDEYVGKITKELEGSDKIDQA−−−ISSQLASNKMNDDQYINNKRDTLKALEKDVNQRSDFNKQRKQALKQDIRQTEQRMNQQHDLILNQLQQSKDKHKATQSILDKVMSQNEAKQAMKRIQTKGKTDHQIANQIDKQLDGLAHTSSDNILKSMLDQSKDKQQLIKQLLATRLGDKEAQRIAKQLANGQLSNQQIVEQLKRHIDKQGHVSADDILNDVLNNAKDKRQAIETILATRIEQGKAKVLADVINRIQSDKESALDLIKSAINGKANDLLQLQQKMDSAKKDLDYIVSPIKNRPSIFDRINQQSNQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSRLLDQLNSGGSLLDSILDIPTPTPEKGLTLGS−−−NDGFLDGLFNDDGNLSLPDAGQAVKQHWMPIALVIAIIGGSMIWFSQRKKSK   
fig|1213730.3.peg.561   Staphylococcus aureus M0877      AKYRGKPFRLYVKLSCSTMMATSIILTNILPYDAQAVSEKDTEI−−SKEILSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGSHIEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSD−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTAATKH−−−−−−−−−−GEKDNKNDEAMVDNALEDLDHLSQQIRKS−−−−−−−−−−−−−−−−−−−KDTSKDPEVSTTDNNHEVAKTPNNDDSGHGVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKHATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNISLPKAGETIKEHWLPISVIVGAMGVLMVWLSRRNKLKNKA
fig|1169255.3.peg.578   Staphylococcus aureus M0946      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAVSEKDTEI−−SKELLSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGSQIEMNGR−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSD−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLSQQIHKS−−−−−−−−−−−−−−−−−−−−−−−EDSAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKHATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|546342.3.peg.550   Staphylococcus aureus subsp. aureus str. JKD6008      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAVSEKDTEI−−SKELLSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGSQIEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSD−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLSQQIHKS−−−−−−−−−−−−−−−−−−−−−−−EDSAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKHATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|585152.3.peg.2645   Staphylococcus aureus subsp. aureus D139      AKYRGKPFQLYVKLSCSTMLATSIILTNILPYDAQAASEKDTEI−−STEILSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGFQIEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVDKALEDLEHLNQQIRKS−−−−−−−−−−−−−−−−−−−KDTSEDQAVSTTDNYHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|585150.3.peg.42   Staphylococcus aureus subsp. aureus C160      AKYRGKPFQLYVKLSCSTMLATSIILTNILPYDAQAASEKDTEI−−STEILSKQDLLDKVDKANRQIEQLKQLSASS−−−−KAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGFQIEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVDKALEDLEHLNQQIRKS−−−−−−−−−−−−−−−−−−−KDTSEDQAVSTTDNYHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|585155.3.peg.200   Staphylococcus aureus subsp. aureus H19      AKYRGKPFQLYVKLSCSTMLATSIILTNILPYDAQAASEKDTEI−−STEILSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGFQIEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVDKALEDLEHLNQQIRKS−−−−−−−−−−−−−−−−−−−KDTSEDQAVSTTDNYHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTVQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQRILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|273036.6.peg.2654   Staphylococcus aureus RF122      AKYRGKPFQLYVKLSCSTMMAISIILTNILPYDAQAASENDTEI−−SKEILSKQDLLDKVDKANRQIEQLKQLSASSKAHYKAQLNEAKTALQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKGSQIELNGE−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSKVDGGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEVMVDKALEDLDHLNQQIRKS−−−−−−−−−−−−−−−−−−−KDTSKDPAVSTTDNNHEVAKTSNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKMAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARNNDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKSEADKLAKDWTNKGLSNRQIVDQLKKRFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYVLSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|426430.8.peg.2758   Staphylococcus aureus subsp. aureus str. Newman      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−TKEILSKQDLLDKVDKAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKGLEDLDHLNQQIHKSKDAS−−−−−−−−−−−−−−−KDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|904778.3.peg.2556   Staphylococcus aureus subsp. aureus IS-88      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−TKEILSKQDLLDKVDKAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAS−−−−−−−−−−−−−−−KDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|1158707.3.peg.486   Staphylococcus aureus M1007      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−TKEILSKQDLLDKVDKAIRQIEQLKQLSASSKEHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAS−−−−−−−−−−−−−−−KDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEAVKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSDLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGVTIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|548474.3.peg.225   Staphylococcus aureus subsp. aureus TCH130      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−SKEILSKQDLLDKVDKAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHSEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAS−−−−−−−−−−−−−−−KDTSEDPAVSTTDNNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYYKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKEILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPRPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|931441.3.peg.174   Staphylococcus aureus subsp. aureus CIG1835            PFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−SKEILSKQDLLDKVDKAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAL−−−−−−−−−−−−−−−KYASKDPAVSTTDSNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|450394.6.peg.1652   Staphylococcus aureus subsp. aureus USA300_TCH959      AKYRGKPFQLYVKLSCSTMMATSIILTNILPYDAQAASEKDTEI−−SKEILSKQDLLDKVDKAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KDNKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKH−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAL−−−−−−−−−−−−−−−KDASKDPAVSTTDSNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−RLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLSISVIVGAMGVLMIWLSRRNKLKNKA
fig|1158692.3.peg.2396   Staphylococcus aureus M0687      AKYRGKPFLLYVKLSCSTMMASSIILTNILPYDAQAASEKDTEI−−SKEILSKQDLLDKVDKAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KENKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKY−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAL−−−−−−−−−−−−−−−KDASKDPAVSTTDSNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−QLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA
fig|1157014.3.peg.2507   Staphylococcus aureus M0192      AKYRGKPFQLYVKLSCSTMMASSIILTNILPYDAQAASEKDTEI−−SKEILSKQDLLDKVDKAIRQIEQLKQLSASSKAHYKAQLNEAKTASQIDEIIKRANELDS−−−−−−−−−−−−−−−−−−−KENKSSHTEMNGQ−−−−−−−−−−−−SDIDSKLDQLLKDLNEVSSNVDRGQQSG−−−−−−−−−−−−−−−−−EDDLNAMKNDMSQTATTKY−−−−−−−−−−GEKDDKNDEAMVNKALEDLDHLNQQIHKSKDAL−−−−−−−−−−−−−−−KDASKDPAVSTTDSNHEVAKTPNNDGSGHVVLN−−−−−−KFLSNEENQSHSN−−−−−−−−QLTDKLQGSDKINHA−−−MIEKLAKSNASTQHYTYHKLNTLQSLDQRIANTQLPKNQKSDLMSEVNKTKERIKSQRNIILEELARTDDKKYATQSILESIFNKDEADKILKDIRVDGKTDQQIADQITRHIDQLSLTTSDDLLTSLIDQSQDKSLLISQILQTKLGKAEADKLAKDWTNKGLSNRQIVDQLKKHFASTGDTSSDDILKAILNNAKDKKQAIETILATRIERQKAKLLADLITKIETDQNKIFNLVKSALNGKADDLLNLQKRLNQTKKDIDYILSPIVNRPSLLDRLNKNGKTTD−−−−−−−−−−−−−−−−−−−−−−−−−−−LNKLANLMNQGSNLLDSIPDIPTPKPEKTLTLGK−−−GNGLLSGLLNADGNVSLPKAGETIKEHWLPISVIVGAMGVLMIWLSRRNKLKNKA