(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009962

fig|396513.4.peg.1975   Staphylococcus carnosus subsp. carnosus TM300     VLRLVLILIAFVANTTLTYYLIDFGEVLQNFLKSMSISMILVFIFYYAKLVIETKR
fig|553212.3.peg.109   Staphylococcus capitis SK14     MLRLFLIFLAFIINTTITYLWTTEGTWVNLLFKSLSLSMILVFMFYYIRFVIENKS
fig|525378.3.peg.2169   Staphylococcus epidermidis M23864:W1     MLRLFLIFIAFIINTTITYLGTTEGTWVNLLFKSLSLSMILVFMFYYIRFVIENRN
fig|426430.8.peg.2637   Staphylococcus aureus subsp. aureus str. Newman     MLRLSIIFIAFIINTTITYGYTTEGTWVNLLFKSLSLSMIIVFMFYYIRFVIEKKR
fig|596319.3.peg.16   Staphylococcus warneri L37603     MLRLTLIFIAFIINTTITYLWTTEGTWVNLLFKSLSLSMIIVFMFYYIRFVIENRG
fig|904143.3.peg.1908   Staphylococcus epidermidis A487     MLRLTLIFIAFIINTTITYLWTTEGTWVNLLFKSLSLSMIIVFMFYYIRFVIENRG
fig|596317.3.peg.607   Staphylococcus epidermidis SK135     MLRLFLIFIAFIINTTITYLWTIEGTWPNLLFKSLSLSMIIVFMFYYIRFVIENKK
fig|904328.3.peg.233   Staphylococcus epidermidis VCU105     MLRLFLIFIAFIINTTITYLWTIEGTWPNLLFKSLSLSMIIVFMFYYIRFVIENKK
fig|525376.3.peg.1273   Staphylococcus epidermidis W23144     MLRLFLIFIAFIINTTITYLWTIEGTWPNLLFKSLSLSMIIVFIFYYIRFVIEDKK
fig|698737.3.peg.461   Staphylococcus lugdunensis HKU09-01     MRRLFGIFLAFTINTTMTYYLTTEGTWENLLLQCMSLSMIIVFFFYYFQFIKKAKK
fig|629742.3.peg.1255   Staphylococcus hominis SK119     MLRLYILFLAFIINTTLTRVWTIEGTWEHLLLQSMSMSIMFVFLFYYVCFMLENRK
fig|279808.3.peg.631   Staphylococcus haemolyticus JCSC1435     MLRLCIIFFIFVTNTTITQLWTVEGTWENLLLQSMSLSMIIVFLFYYVGFVIAEKK