(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00023626

fig|596319.3.peg.2221   Staphylococcus warneri L37603            KKAFLNQFFGTKRYLYQDDVKVAHMHIVNGVYYLHGHFKTQWTNFKTTFNSEREFNEYIKQHGLSLEDERQLSLF
fig|553583.3.peg.2380   Staphylococcus aureus A9635             KSLIKQFFDSKQYLYQADRKVAHVHVVNDIYLIHGHHKTMFKGVKKTFNNKLEFANYIESNELYFEKAKQLSLF
fig|904730.3.peg.2005   Staphylococcus aureus subsp. aureus 21200             KSLIKQFFDSKQYLYQADRKVAHVHVVNDIYLIHGHHKTMFKGVKKTFNNKLEFANYIESNELYFEKAKQLSLF
fig|931453.3.peg.2136   Staphylococcus aureus subsp. aureus CIG149        TDSARKERLNQFFGSKRYLYQDNERVAHVHEVNGTYYFHGHYKTMFKGVKKTFDTAEELEIYIKQHDLEYEEQKQPTLF
fig|1116215.3.peg.873   Staphylococcus aureus subsp. aureus VRS2        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1156999.3.peg.1419   Staphylococcus aureus HI022        TDSARKERLNQFFGSKRYLYQDNERVAHTHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553590.4.peg.553   Staphylococcus aureus A9754        TDSARKERLNQFFGSKRYLYQDNERVAHTHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|904778.3.peg.754   Staphylococcus aureus subsp. aureus IS-88        TDSARKERLNQFFGSKRYLYQDNERVAHTHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|904782.3.peg.1177   Staphylococcus aureus subsp. aureus IS-111        TDSARKERLNQFFGSKRYLYQDNERVAHTHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1157006.3.peg.988   Staphylococcus aureus M0035        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNSTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158709.3.peg.1568   Staphylococcus aureus M1015        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNSTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|548470.3.peg.23   Staphylococcus aureus subsp. aureus MN8        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNSTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|681288.4.peg.847   Staphylococcus aureus subsp. aureus ED98     MLKTDSARKEHLNQFFGSKRYLYQDNERVAHIHVVNDIYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|1074252.3.peg.1410   Staphylococcus aureus subsp. aureus HO 5096 0412        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNDIYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|644279.4.peg.1619   Staphylococcus aureus subsp. aureus 132        TDSARKERLNQFFGSKRYLYQDNERVAHIHVVNDIYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|585152.3.peg.1814   Staphylococcus aureus subsp. aureus D139     MPKTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNDIYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158510.3.peg.1038   Staphylococcus aureus M0108         DSARKEHLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|359787.11.peg.2118   Staphylococcus aureus subsp. aureus JH1     MTMTYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|225979.1.peg.27   Staphylococcus phage phiN315     MTMTYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553580.3.peg.2778   Staphylococcus aureus A8819     MTMTYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKT                           
fig|553577.3.peg.2750   Staphylococcus aureus A8796     MTMTYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELE                   
fig|1116214.3.peg.2777   Staphylococcus aureus subsp. aureus VRS1        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1116215.3.peg.1014   Staphylococcus aureus subsp. aureus VRS2        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1116220.3.peg.1911   Staphylococcus aureus subsp. aureus VRS7        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1116220.3.peg.2801   Staphylococcus aureus subsp. aureus VRS7        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1157006.3.peg.1498   Staphylococcus aureus M0035        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1157036.3.peg.1913   Staphylococcus aureus B53639        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158486.3.peg.1485   Staphylococcus aureus M1320        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158510.3.peg.1929   Staphylococcus aureus M0108        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158691.3.peg.1006   Staphylococcus aureus M0676        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1158691.3.peg.1888   Staphylococcus aureus M0676        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1169267.3.peg.1418   Staphylococcus aureus M1142        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1169274.3.peg.1953   Staphylococcus aureus M1309        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|505321.3.peg.454   Staphylococcus aureus subsp. aureus str. CF-Marseille        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553577.3.peg.2969   Staphylococcus aureus A8796        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553580.3.peg.2900   Staphylococcus aureus A8819        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|904775.3.peg.1123   Staphylococcus aureus subsp. aureus IS-3        TYNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553601.3.peg.2181   Staphylococcus aureus A10102        TYNARKEYLNQFFGSKRYLYQDNERVARIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|553580.3.peg.2623   Staphylococcus aureus A8819                                 MAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|889933.4.peg.1789   Staphylococcus aureus subsp. aureus ECT-R 2                                 MAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|931453.3.peg.1049   Staphylococcus aureus subsp. aureus CIG149                                 MAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|426430.8.peg.2083   Staphylococcus aureus subsp. aureus str. Newman        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|548470.3.peg.2024   Staphylococcus aureus subsp. aureus MN8        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|585151.3.peg.1537   Staphylococcus aureus subsp. aureus C427        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|644279.4.peg.2133   Staphylococcus aureus subsp. aureus 132        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1116214.3.peg.747   Staphylococcus aureus subsp. aureus VRS1        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1116220.3.peg.811   Staphylococcus aureus subsp. aureus VRS7        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1157006.3.peg.337   Staphylococcus aureus M0035        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1157036.3.peg.777   Staphylococcus aureus B53639        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1158486.3.peg.369   Staphylococcus aureus M1320        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1158510.3.peg.764   Staphylococcus aureus M0108        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|1158709.3.peg.915   Staphylococcus aureus M1015        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|359787.11.peg.929   Staphylococcus aureus subsp. aureus JH1        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|553577.3.peg.1378   Staphylococcus aureus A8796        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|553580.3.peg.1720   Staphylococcus aureus A8819        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|553601.3.peg.2655   Staphylococcus aureus A10102        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|904775.3.peg.2697   Staphylococcus aureus subsp. aureus IS-3        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWKSVKKTFDTAEELEIYIKQHGLEYEEQKELTLF
fig|158878.14.peg.902   Staphylococcus aureus subsp. aureus Mu50     MPKTDSARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQSVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|273036.3.peg.1676   Staphylococcus aureus RF122     MTMTDNARKEYLNQFFGSKRYLYQDNEQVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|273036.6.peg.1840   Staphylococcus aureus RF122        TDNARKEYLNQFFGSKRYLYQDNEQVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|585150.3.peg.2453   Staphylococcus aureus subsp. aureus C160                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAGELEIYIKQHDLEYEEQKQLTLF
fig|1158466.3.peg.1685   Staphylococcus aureus M1092                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|452948.4.peg.2811   Staphylococcus aureus 930918-3                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|904731.3.peg.2049   Staphylococcus aureus subsp. aureus 21201                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|1116214.3.peg.2779   Staphylococcus aureus subsp. aureus VRS1        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEKQKQLTLF
fig|1158466.3.peg.2576   Staphylococcus aureus M1092        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEKQKQLTLF
fig|1158485.3.peg.1207   Staphylococcus aureus M1311        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEKQKQLTLF
fig|450394.6.peg.2504   Staphylococcus aureus subsp. aureus USA300_TCH959        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEKQKQLTLF
fig|553583.3.peg.576   Staphylococcus aureus A9635        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEKQKQLTLF
fig|505321.3.peg.286   Staphylococcus aureus subsp. aureus str. CF-Marseille        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLTLF
fig|585150.3.peg.2601   Staphylococcus aureus subsp. aureus C160        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEDLEIYIKQHGLEYEEQKQLTLF
fig|1157036.3.peg.1788   Staphylococcus aureus B53639     MPKTDNARKEYLNQFFRSKRYLYQDNERVAHTHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|1158486.3.peg.1357   Staphylococcus aureus M1320     MPKTDNARKEYLNQFFRSKRYLYQDNERVAHTHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|1158691.3.peg.1770   Staphylococcus aureus M0676     MPKTDNARKEYLNQFFRSKRYLYQDNERVAHTHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|1169274.3.peg.996   Staphylococcus aureus M1309        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|553577.3.peg.2851   Staphylococcus aureus A8796        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|553594.3.peg.2743   Staphylococcus aureus A9765        TDNARKEYLNQFFGFKRYLYQDNERVAHIHVVNGTYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|426430.8.peg.1099   Staphylococcus aureus subsp. aureus str. Newman        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|426430.8.peg.1948   Staphylococcus aureus subsp. aureus str. Newman        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|426430.8.peg.305   Staphylococcus aureus subsp. aureus str. Newman        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|585153.3.peg.2167   Staphylococcus aureus subsp. aureus E1410        TDSARKEYLNRFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
fig|553571.3.peg.2309   Staphylococcus aureus A6300     MPKTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEEFEIYIKQYGLEYEEQKQLTLF
fig|1158709.3.peg.363   Staphylococcus aureus M1015        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEKYIKQHGLEYEEQKQLTLF
fig|359787.11.peg.369   Staphylococcus aureus subsp. aureus JH1        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELEKYIKQHGLEYEEQKQLTLF
fig|553581.3.peg.326   Staphylococcus aureus A9299        TDSARKEYLNRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTTEELEKYIKQHGLEYEEQKQLTLF
fig|553594.3.peg.2724   Staphylococcus aureus A9765        TDSARKEYLNQFFGSKRYLYQNNERVAHIHVLNDTYYFHGHIVPGWQGVKKTFDTAEELEKIYK               
fig|1116214.3.peg.2746   Staphylococcus aureus subsp. aureus VRS1        TDSARKEYLNQFFGSKRYLYQNNERVAHIHVLNDTYYFHGHIVPGWQGVKKTFDTAEELEKYIKQHGLEYEEQKQLTLF
fig|452948.4.peg.2836   Staphylococcus aureus 930918-3        TDSARKEYLNQFFGSKRYLYQNNERVAHIHVLNDTYYFHGHIVPGWQGVKKTFDTAEELEKYIKQHGLEYEEQKQLTLF
fig|505321.3.peg.2022   Staphylococcus aureus subsp. aureus str. CF-Marseille        TDSARKEYLNQFFGSKRYLYQDNERVGHIHVVNDTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|553581.3.peg.228   Staphylococcus aureus A9299        TDSARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|585153.3.peg.277   Staphylococcus aureus subsp. aureus E1410        TDSARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|585149.6.peg.2162   Staphylococcus aureus subsp. aureus C101     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEGQKQLTLF
fig|585153.3.peg.2608   Staphylococcus aureus subsp. aureus E1410     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEGQKQLTLF
fig|585157.3.peg.1657   Staphylococcus aureus subsp. aureus M809                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEGQKQLTLF
fig|585155.3.peg.2589   Staphylococcus aureus subsp. aureus H19     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEEL                    
fig|548470.3.peg.1889   Staphylococcus aureus subsp. aureus MN8     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|553581.3.peg.96   Staphylococcus aureus A9299     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPGWQGVKKTFDTAEELEIYIKQHGLEYEEQKQLNLF
fig|553573.3.peg.1056   Staphylococcus aureus A8115     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTTEELETYIKQHGLEYEEQKQLTLF
fig|585152.3.peg.1952   Staphylococcus aureus subsp. aureus D139     MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTTEELETYIKQHGLEYEEQKQLTLF
fig|553583.3.peg.1963   Staphylococcus aureus A9635                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTPEELETYIKQHGLEYEEQKQLTLF
fig|681288.4.peg.2012   Staphylococcus aureus subsp. aureus ED98                                 MAHIHVVNGTYYLHGHIVPSWQGVKKTYDTAEELETYIKQHGLEYEEQKQLTLF
fig|1137133.3.peg.1589   Staphylococcus aureus subsp. aureus MRGR3                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|450394.6.peg.70   Staphylococcus aureus subsp. aureus USA300_TCH959                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|548473.6.peg.1637   Staphylococcus aureus subsp. aureus TCH60                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|904744.3.peg.125   Staphylococcus aureus subsp. aureus 21259                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHGLEYEEQKQLTLF
fig|1156999.3.peg.1924   Staphylococcus aureus HI022                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQGLEYEEQKQLTLF
fig|904782.3.peg.410   Staphylococcus aureus subsp. aureus IS-111                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQGLEYEEQKQLTLF
fig|553573.3.peg.96   Staphylococcus aureus A8115        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFNTAEELETYIKQHGLEYEEQKQLTLF
fig|585151.3.peg.1680   Staphylococcus aureus subsp. aureus C427        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKMFDTAEELETYIKQHGLEYEEQKQLTLF
fig|904775.3.peg.1623   Staphylococcus aureus subsp. aureus IS-3        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKMFDTAEELETYIKQHGLEYEEQKQLTLF
fig|553590.4.peg.1598   Staphylococcus aureus A9754        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQGLEYEEQKQLTLF
fig|904778.3.peg.96   Staphylococcus aureus subsp. aureus IS-88        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQGLEYEEQKQLTLF
fig|585155.3.peg.2438   Staphylococcus aureus subsp. aureus H19        TDNARKEYLNQFFGSKRYLYRDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTTEEL                    
fig|553577.3.peg.2974   Staphylococcus aureus A8796        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|904775.3.peg.1589   Staphylococcus aureus subsp. aureus IS-3        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|359787.11.peg.1096   Staphylococcus aureus subsp. aureus JH1     MTMTDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|1116220.3.peg.2743   Staphylococcus aureus subsp. aureus VRS7        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|553571.3.peg.256   Staphylococcus aureus A6300        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|553601.3.peg.208   Staphylococcus aureus A10102        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|904731.3.peg.2289   Staphylococcus aureus subsp. aureus 21201        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|452948.4.peg.2835   Staphylococcus aureus 930918-3        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNDTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHDLEYEEQKQLTLF
fig|553594.3.peg.2703   Staphylococcus aureus A9765        TDSGRKEYLKHFFGSKRYLYQDNERVAHIHVVNDTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHDLEYEEQKQLTLF
fig|553577.3.peg.2788   Staphylococcus aureus A8796        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNDTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHDLEYEEQKQLTLF
fig|553580.3.peg.2654   Staphylococcus aureus A8819        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNDTYYFHGHIVPGWQGVKKTFDTAEELETYIKQHDLEYEEQKQLTLF
fig|1169271.3.peg.1190   Staphylococcus aureus M1256        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|585161.3.peg.1822   Staphylococcus aureus subsp. aureus WW2703/97        TDSARKEYLSRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|1169267.3.peg.535   Staphylococcus aureus M1142                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|158878.14.peg.2049   Staphylococcus aureus subsp. aureus Mu50                                 MAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|93062.4.peg.810   Staphylococcus aureus subsp. aureus COL        TDSARKEYLNRFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|505321.3.peg.1545   Staphylococcus aureus subsp. aureus str. CF-Marseille        TDSARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|282459.5.peg.950   Staphylococcus aureus subsp. aureus MSSA476        TDSGRKEYLNQFFGSKSYLYQDNERVAHTHVVNGNYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|644279.4.peg.1273   Staphylococcus aureus subsp. aureus 132        TDNARKEYLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELETYIKQSDLEYEEQKQLTLF
fig|585151.3.peg.1456   Staphylococcus aureus subsp. aureus C427        TDSARKERLNQFFGSKRYLYQDNERVAHIHVANGNYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|585157.3.peg.1191   Staphylococcus aureus subsp. aureus M809                                 MAHIHVANGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF
fig|585149.6.peg.1631   Staphylococcus aureus subsp. aureus C101     MPKTDSARKEYLNQFFGSKRYLYQDNERVAHIHVANGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQDLEYEEQKQLTLF