(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00012374

fig|1158711.3.peg.648   Staphylococcus aureus M1036     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIAATSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|1303787.3.peg.1707   Staphylococcus aureus M1466     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIAATSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|553594.3.peg.22   Staphylococcus aureus A9765     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIAATSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|1303787.3.peg.814   Staphylococcus aureus M1466     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIAATSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|426430.8.peg.1122   Staphylococcus aureus subsp. aureus str. Newman     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIAATSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|426430.8.peg.1925   Staphylococcus aureus subsp. aureus str. Newman     MNVEINGKSLELSFGFKFLREIDNRLGLKVE−−−−QASIGQGVSMLPVGLESGNPVVIGEVLIASTSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVE
fig|458233.11.peg.1039   Macrococcus caseolyticus JCSC5402     LTINTNGKVLELKFGLGELNAVDKALGLEIE−−−−KINLGEGFEMLVPKLQTANPLALAKIIPALTLNQPGRPKTEDEVLEVLKAVKEQFGSLQAFCDAVLNEMKHHFLTQDLVK
fig|553212.3.peg.2142   Staphylococcus capitis SK14     MEIKFNGKTIELSFGLKFLNIIDKEMGMEAE−−−−QVNFGKGTEMLVPALESHSVVDVAKVIKAATAQEKGAPKTEEDLEAVVEDVIENRGLEEFCNEVIEELGKRVLTQNLVP
fig|698737.3.peg.2189   Staphylococcus lugdunensis HKU09-01     MYINFKGKELELSFGLKFLRIIDKVMAMESE−−−−NISFGQGTQMLVPRLEMADAVSLSYIIEAATAHHNKAPKTESELEAVIEDIAEEHGIEEFCQDIIKELGKRVMTQNLVP
fig|525362.3.peg.1043   Lactobacillus ruminis ATCC 25644     MILTINNQEYELKFGFAFIKKINQLMGLKDSD−−−−GAEMGNGLQRVSFMLAQEEPEAVATVIMAATDHLKKRPTGKEIESFLEEYA−−−DFEGLLKEIDESLSN         
fig|221109.1.peg.212   Oceanobacillus iheyensis HTE831     MEFKVNNKEYVLKFGIKFIRQLDEVYKVDYQ−−−−GLEFGMGVNLAYINLVQKNPTVLVEVIKAGISHHTNTPKQSTIESAIEEYAEIHDGLSTLFTELLGELGKSVMVKDTLK
fig|565642.4.peg.2711   Enterococcus faecalis ATCC 4200     MNLEINGKTIEVKFTIGVIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|1169293.3.peg.1339   Enterococcus faecalis T5     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KLGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|1151202.3.peg.225   Enterococcus faecalis 7330259-5     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|1157369.3.peg.1480   Enterococcus faecalis UAA769     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|1158662.3.peg.1227   Enterococcus faecalis T16     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|1169252.3.peg.1422   Enterococcus faecalis SF5039     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|565645.4.peg.2172   Enterococcus faecalis Merz96     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|565646.5.peg.2431   Enterococcus faecalis HIP11704     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|749492.3.peg.533   Enterococcus faecalis TX2141     MNLEINGKTIEVKFTIGAIRELDKRYQIENG−−−−AAKFGMGISSAMIYLRQYNPVILVDIMEALQSGQL−−KIGKSEIEAWLMTQD−−−−−VKKLSDDLLKEMGKQPLTKPMID
fig|525326.3.peg.342   Lactobacillus gasseri JV-V03     MQIKINGKTYDLNFGIRWVLLMNQNHNISGN−−−−GLSQGMGINQAVASLSQYDPIGLSEILVNATWINKERPTSADIDHYLETDA−−−DIKKLCDSILKEIETANATKAQVK
fig|633699.4.peg.766   Lactobacillus johnsonii FI9785     MELTINGKKYQLNFGVGFVRDLDEKYGMSNQA−−−−GFSLGMALTKALPSLNAYDPAVLAEVIQCAA−−−EPSVSLAKVDGLIDDPET−−DIEKLFTDVLKELSEANAVKLAAK
fig|575607.3.peg.684   Lactobacillus jensenii SJ-7A-US     MELEIKGKKYELNFGVKFVRLADDRLGLKNAL−−−−NVEFGMALGRIIPSLKGYDTAVLSEVISIAA−−−TPSLSLNDADAYIDDPNT−−DIEALLKDVLKEMESANAVKLAAK
fig|537973.8.peg.955   Lactobacillus paracasei subsp. paracasei 8700:2     MQLTINGKEYELNFGVRFVRELDKTIGASIK−−−−GINFGMGVAKALVGLGSYDSAVLSDVIYAATAVSKKRPSTKEVDDFIDEDGT−−DLDSLFKQIPEEMRAANAVKAATK
fig|998820.3.peg.1294   Lactobacillus casei BD-II     MQLTINGKEYELNFGVRFVRELDKTIGASIK−−−−GINFGMGVAKALVGLGSYDSAVLSDVIYAATAVSKKRPSTKEVDDFIDEDGT−−DLDSLFKQIPEEMRSANAVKAATK
fig|568703.9.peg.1057   Lactobacillus rhamnosus GG     MQLTINGKEYELNFGVRFVREMDKNMGAVMH−−−−GINFGMGVAKALAGLSAYDAAVLSDTIYSATVASKKRPSASEVDDFIDSNS−−−DLDSLFKQVSDEMNSANAVKAVAK
fig|575599.3.peg.1809   Lactobacillus fermentum 28-3-CHN     MEIKINGKNVELNFGVAFVRELDKVAGMKVN−−−−GQSFGFGLTKSLPALQAYDPAVLADVLYCAAWDNKPRPTQKAIDEFIDTDS−−−DLEKVFDEVNKAIAESNAVKVAAK
fig|585506.3.peg.1213   Weissella paramesenteroides ATCC 33313     MQIKINGKQVDLKFGVKFVRELDKVAGLDLN−−−−GASFGMGLTKSIPSLNAADPAVLADVIYSAASTNNAFRPSQDDVDDFIDNYED−−DLEKLFDDVIKEMSQANAIKVALK
fig|563194.3.peg.1922   Pediococcus acidilactici 7_4     MKITINGKEQELNFGVRFVRELDKVAGMEAG−−−−GMSLGMGLTKSLPALSAYDPAVLSDVIYSATFRNSPRVSRNDVDDYLDSLTSVKEFEKLFDDVSKEVKKANVLKVALK
fig|278197.12.peg.752   Pediococcus pentosaceus ATCC 25745     MKITIAGKEQELNFGVRFVRELDKVAGMEAG−−−−GMSLGMGLTKSLPALNAYDPAVLSDVIYSATFRNSPRVGRNDVDDYLDGLTSVKEFEKLFDDVSKEVKKANVLKVALK
fig|278197.10.peg.702   Pediococcus pentosaceus ATCC 25745     MKITIAGKEQELNFGVRFVRELDKVAGMEAG−−−−GMSLGMGLTKSLPALNAYDPAVLSDVIYSATFRNSPRVGRNDVDDYLDGLTSVKEFEKLFDDVSKEVKKANVLKVALK
fig|471876.6.peg.1515   Streptococcus pyogenes NZ131     MQLEIKGKTHNVKFGTRFVAEMDRAHVTERE−−−−GMKFGTGLQSTVPFLFERNVVTLAEIIHVGTITESPRPSLNDIYDYIDEVE−−−DIEKLFDDVLDELRQSNASKLFMA
fig|186103.3.peg.1121   Streptococcus pyogenes MGAS8232     MQLEIKGKTHNVKFGTRFVAEMDKAHVTERE−−−−GMKFGTGLQSTVPFLFERNVVTLAEIIHVGTITESPRPSLNDIYDYIDEVE−−−DIEKLFNDVLDELRQSNASKLFIA
fig|286636.3.peg.1616   Streptococcus pyogenes MGAS10394     MQLEIKGKTHNVKFGTRFVAEMDKNHVTERD−−−−GMKFGTGLQSTVPFLFERNVVTLAEIIHVGTITESPRPSLNDIYDYIDEVD−−−DIEKLFNDVLDELRQSNASKLFMA
fig|553482.3.peg.1785   Streptococcus equi subsp. equi 4047     MQLEIKGKTHNIKFGTRFVAEMDKNHIAERE−−−−GMKFGAGLQSTVPFLFERNVVTLAEIIYTGTITESPRPSLNDIYDYIDEAE−−−DIEKLFDDVLDELRQSNASKLFI 
fig|319701.3.peg.1366   Streptococcus pyogenes MGAS6180     MQLEIKGKTHNVKFGTRFVAEMDKNHIAERQ−−−−GFKFGAGLQSSVPFLIDHSVVTLAEVIYTGTITEPPRPSLNDIYDYIDEVE−−−DIEKLFDDVLDELRQSNASKLFMA
fig|160490.1.peg.751   Streptococcus pyogenes M1 GAS     MQLEIKGKTHNVKFGTRFVAEMDKNHIAERQ−−−−GFKFGAGLQSSVPFLIDHSVVTLAEVIYTGTITEPPRPSLNDIYDYIDEVE−−−DIEKLFDDVLDELRQSNASKLFMA
fig|1245478.3.peg.3   Enterococcus faecium LCT-EF258     MKLKIKGKEYSFKFGTKFVRELDKVMPFIDG−−−−NMEFGMGLSAKVLPELRSYNVNTLSRVLEIANRTEEETITLDEMDDYIDEVK−−−DIEKLFDEVLKELAESNAGKLAVR
fig|1138894.3.peg.1916   Enterococcus faecium E1392     MKLKIKGKEYSFKFGTKFVRELDKVMPFVDG−−−−NMEFGMGLSAKVLPELRSYNVNTLSRVLEIANRTEEETITLDEMDDYIDEVK−−−DIEKLFDEVLKELAESNAGKLAVR
fig|1151202.3.peg.1480   Enterococcus faecalis 7330259-5     MQIEIKGKKYNCIFGVKFIRELDKQHGVVRN−−−−DVNLGMGLTTLLPQLVSGNIVVLSDVLYTATITEKSRPSKDEVDEFVETVD−−−DIEALFDETLKYLEESNAGKLTVR
fig|749492.3.peg.116   Enterococcus faecalis TX2141     MQIEIKGKKYNCIFGVKFIRELDKQHGVVRN−−−−DVNLGMGLTTLLPQLVSGNIVVLSDVLYTATITEKSRPSKDEVDEFVETVD−−−DIEALFDETLKYLEESNAGKLTVR
fig|1157369.3.peg.2225   Enterococcus faecalis UAA769     MQIEIKGKKYNCIFGVKFIRELDKQHGVVRN−−−−DVNLGMGLTTLLPQLVSGNIVVLSDVLYTATITEKSRPSKDEVDEFVETVD−−−DIEALFDETLKNLEESNAGKLTVR
fig|565645.4.peg.1482   Enterococcus faecalis Merz96     MQIEIKGKKYNCIFGVKFIRELDKQHGVVRN−−−−DVNLGMGLTTLLPQLVSGNIVVLSDVLYTATITEKSRPSKDEVDEFVETVD−−−DIEALFDETLKNLEESNAGKLTVR
fig|1158662.3.peg.1952   Enterococcus faecalis T16     MQIEIKGKKYNCIFGVKFIRELDKQHGVVRN−−−−DVNLGMGLTTLLPQLVSGNIVVLSDVLYTATITEKSRPSKDEVDEFVETVD−−−DIETLFDETLKNLEESNAGKLTVR
fig|349123.6.peg.472   Lactobacillus reuteri 100-23     MKLKIDGKDYSFIFGVKFLRNLDKNRGVEGERNGMKMNFGMGLTVLMPALMTKDASALADTLYAAA−−−KDNVTQDQIDNYIDNCK−−−DLNGLFSRVINEIKASNTAKPVVK
fig|272622.8.peg.1284   Lactococcus lactis subsp. cremoris SK11     MELTINEKQYVFIFGYRFIKELNKKNEVTER−−−−GMTLKAGLDNALMNFFSGDIETLVEMLKTANATENPRVSEKGIVEWIEENG−−−−−VDALFDLVLEELKKSEFTK    
fig|272622.8.peg.1914   Lactococcus lactis subsp. cremoris SK11     MELTINDKQYVFIFGYRFIKELNKKNEVTER−−−−GMTLKAGLDNALMNFFSGDIETLVEMLKTANATENPRVSEKWIVEWIEENG−−−−−IDMLFDLVLEELKKSEFTK    
fig|476272.5.peg.2328   Blautia hydrogenotrophica DSM 10507     LELTINNQVYAFRFGIGFLREINKQINVPVEGLPGVKKDVGFNYKFAGILNGDVEALIDVLDLANKGMEPRVTRKILDSYIEDEDT−−DIDAVFEEVLDFLKKANCTKNTVR
fig|556270.3.peg.652   Mollicutes bacterium D7     MELTINGIVYKFKASIGFVRKVNKNVTQKDEL−−−−GVEKQVGLTYLVAGLVDGEIEELINALDYLNDGMTPRVTREQIEEYIDNETT−−DVEKLFEVVIDFLSSANASKVAIK
fig|565646.5.peg.147   Enterococcus faecalis HIP11704        TINGKKYPLIFGFKFLNEINALKP−−−−−−−−−DVEEVDGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−VLTLFENFISFLEQAPLT     
fig|1169252.3.peg.2487   Enterococcus faecalis SF5039        TINGKKYPLIFGFKFLNEINALKT−−−−−−−−−DVEEVDGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−ALTLFENFISFLEQAPLT     
fig|749492.3.peg.2655   Enterococcus faecalis TX2141        TINGKKYPLIFGFKFLNEINALKP−−−−−−−−−DVEEVDGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−ALTLFENFISFLEQAPLT     
fig|1157369.3.peg.2081   Enterococcus faecalis UAA769        TINGKKYPLVFGFKFLNEINALKP−−−−−−−−−DVEEVEGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSDE−−−−ALTLFENFISFLEQAPLT     
fig|1158662.3.peg.1807   Enterococcus faecalis T16        TINGKKYPLVFGFKFLNEINALKP−−−−−−−−−DVEEVEGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSDE−−−−ALTLFENFISFLEQAPLT     
fig|565642.4.peg.1051   Enterococcus faecalis ATCC 4200        TINGKKYPLVFGFKFLNEINALKP−−−−−−−−−DVEEVEGFVQLVGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSDE−−−−ALTLFENFISFLEQAPLT     
fig|1151202.3.peg.789   Enterococcus faecalis 7330259-5        TINGKKYPLVFGFKFLNEINALKP−−−−−−−−−DVEEVDGFVQLIGGLHDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−ALTLFENFISFLEQAPLT     
fig|1169293.3.peg.1026   Enterococcus faecalis T5        TINGKKYPLIFGFKFLNEINALKP−−−−−−−−−DVEEVDGFVQLIGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−ALTLFENFISFLEQAPLT     
fig|565645.4.peg.427   Enterococcus faecalis Merz96        TINGKKYPLIFGFKFLNEINALKP−−−−−−−−−DVEEVDGFVQLIGGLQDGDAFAFQKLMHAALITYD−−DLTTKEIDDYLETSEE−−−−ALTLFENFISFLEQAPLT