(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020486

fig|693216.3.peg.1634   Cronobacter turicensis z3032                                                                          CVVHA−−−−−−QGKFLVVEET−−−INGKALWNQ−−−−PAGHLEADE−−−−−−−−−−−−−−−−TLLEAARRELWEETGIRAEPQHF−−−−−−−−−−−−−−−LRLHQWL−−−APDNT−−PF−−−−−LRFLFSIELD−−−−−APLPTEPHDSDIDLCRWVSADEILS−−−−−−−−−ATNLRSPLVAESIRTWQR
fig|290339.8.peg.1973   Cronobacter sakazakii ATCC BAA-894                                                                          CVVHA−−−−−−QGKFLVVEET−−−INGKALWNQ−−−−PAGHLEADE−−−−−−−−−−−−−−−−TLVEAARRELWEETGIRAEPQHF−−−−−−−−−−−−−−−LRLHQWL−−−APDNT−−PF−−−−−LRFLFSIELD−−−−−APLPTEPHDSDIDLCRWVSAEEILS−−−−−−−−−ATNLRSPLVAESIRTWQR
fig|615.1.peg.178   Serratia marcescens Db11                                                                          CVVHA−−−−−−AGKFLVVEET−−−INGKALWNQ−−−−PAGHLEADE−−−−−−−−−−−−−−−−TLVQAAERELWEETGIRATPQAF−−−−−−−−−−−−−−−LRLHQWI−−−APDRT−−PF−−−−−LRFCFVIELE−−−−−QPLPTEPHDSDIDRCLWLSADEILQ−−−−−−−−−APNLRSALVAESI     
fig|527012.3.peg.1258   Yersinia kristensenii ATCC 33638                                                                          CVVHA−−−−−−QGKFLVVEET−−−INGKKLWNQ−−−−PAGHLEADE−−−−−−−−−−−−−−−−TLLQAAERELWEETGIRASPHSF−−−−−−−−−−−−−−−LRMHQWI−−−APDKT−−PF−−−−−LRFAFVIELK−−−−−EPVATAPQDDDIDCCHWLTADEILQ−−−−−−−−−SDNLRSPLVAESI     
fig|397948.3.peg.28   Caldivirga maquilingensis IC-167                                                                            IIK−−−−−−NGKVLLIRKK−−−−−−RGLGAGYFNGVGGKVEDNE−−−−−−−−−−−−−−−−DVNNAAIRECIEEIGVKPRG−−−−−−−−−−−−−−−−−−LKWMGLLEFWNYDNN−−AIESIH−−−FVHVFTAS−−−−−−DYNGEPRESDEAEPLWFNINEIPF−−−−NSMWEDDSLWLPLIL        
fig|314280.3.peg.4414   Photobacterium profundum 3TCK                                                                       IGIIVVND−−−−−−KGEILIGKRK−−−−−−−NSHAPYYSIPGGHMEIGE−−−−−−−−−−−−−−−−TFTQCAAREMEEETGIIIRN−−−−−−−−−−−−−−−−−−PEVIAIT−−−NNLATFHESGKHYISVALLVTDF−−−−−−TGNAELKEPDKCEGWLWVNPKEVP                            
fig|460265.11.peg.1911   Methylobacterium nodulans ORS 2060                                                                    PYLAASVAVVR−−−−−−DGRVLVAARG−−−−−GSPLRGLYSLPGGLVELGE−−−−−−−−−−−−−−−−PLAETALRELREEVGVEAEIVAS−−−−−−−−−−−−−−−LTPLEVI−−−ERDAD−−GRVLHHFVIVPHAARW−−−−−−LRHEPAPGEEALDVRWVTLAELAA−−−−−−−−−−LPTTEGL          
fig|415426.7.peg.972   Hyperthermus butylicus DSM 5456                                                                          CIILR−−−−−−DGKILVQLSK−−−−−−−−−KGDFYRLPGGRIRPDE−−−−−−−−−−−−−−−−TIVQGLQREVHEELGIEKIEN−−−−−−−−−−−−−−−−−MRLIFIV−−−DSFYKRRSGLVHEVGFYFLCDVG−−−−−−DAEIKPREEHLRIEWIEPEQLDS−−−−−−−−KNF                
fig|155920.4.peg.1490   Xylella fastidiosa subsp. sandyi Ann-1                                                                         YVLSPD−−−−−−QCRVLMIHRNARSGDAHLGKYNGLGGKVEPGE−−−−−−−−−−−−−−−−DVLAGMRRELYEEAGIDCLS−−−−−−−−−−−−−−−−−−IRLRGTI−−−−SWPGFGKQGDDWFGFVFVIDAF−−−−−−QGEPKTHNPEGVLEWVECQRLFE−−−−−−−−−−LPMWE            
fig|405440.3.peg.546   Xylella fastidiosa M12                                                                         YVLSPD−−−−−−QCRVLMIHRNARSGDAHLGKYNGLGGKVEPGE−−−−−−−−−−−−−−−−DVLAGMRRELYEEAGIDCLS−−−−−−−−−−−−−−−−−−IRLRGTI−−−−SWPGFGKQGDDWFGFVFVIDAF−−−−−−QGEPKTHNPEGVLEWVECQRLFE−−−−−−−−−−LPMWE            
fig|155920.4.peg.4021   Xylella fastidiosa subsp. sandyi Ann-1                                                                         YVLSPD−−−−−−QCRVLMIHRNARSGDAHLGKYNGLGGKVEPGE−−−−−−−−−−−−−−−−DVLAGMRRELYEEAGIDCLS−−−−−−−−−−−−−−−−−−IRLRGTI−−−−SWPGFGKQGDDWFGFVFVIDAF−−−−−−QGEPKTHNAEGVLEWVERQRLFE−−−−−−−−−−LPMWE            
fig|391008.3.peg.2442   Stenotrophomonas maltophilia R551-3                                                                         YVLSPD−−−−−−RRQVLMIHRNTRPGDHHLGKYNGLGGKIEPTE−−−−−−−−−−−−−−−−DVAAGMRREIAEEAGIDCMD−−−−−−−−−−−−−−−−−−MRLRGTI−−−−SWPGFGKHGEDWLGFVFVIDSF−−−−−−EGTPHGGNHEGTLEWVDVDKLDQ−−−−−−−−−−LPMWE            
fig|522373.3.peg.2801   Stenotrophomonas maltophilia K279a                                                                         YVLSPD−−−−−−RRQVLMIHRNTRPGDHHLGKYNGLGGKIEPTE−−−−−−−−−−−−−−−−DVAAGMRREIAEEAGIDCTG−−−−−−−−−−−−−−−−−−MRLRGTI−−−−SWPGFGKHGEDWLGFVFVIDSF−−−−−−EGTPHGGNHEGTLEWVDLDKLDA−−−−−−−−−−LPMWE            
fig|40324.1.peg.3579   Stenotrophomonas maltophilia K279a                                                                         YVLSPD−−−−−−RRQVLMIHRNTRPGDHHLGKYNGLGGKIEPTE−−−−−−−−−−−−−−−−DVAAGMRREIAEEAGIDCTG−−−−−−−−−−−−−−−−−−MRLRGTI−−−−SWPGFGKHGEDWLGFVFVIDSF−−−−−−EGTPHGGNHEGTLEWVDLDKLDA−−−−−−−−−−LPMWE            
fig|527021.3.peg.2382   Bacillus thuringiensis Bt407           RIICFEESE−−−−−−−−−−−VAFVPTGFTNMEAIIDAMQTVPVLVDRRSILEYNAVQRHPIPYVIVKH−−−−−−QNKYFFIIREGNSGEIRLIGKMGMLGGHVGEEDIHVSNKDV−−−−DLFKTIENGLYRELTEEAGITSEMIES−−−−−−−−−−−−−−−IHLEGLI−−−KLSG−−GVEDDHLGFVYMVELR−−−−−−TDDIQSQEEGVIKGLWVDKEGLPS−−−−−IKDKLENWSKVVYEEI     
fig|590168.4.peg.1445   Thermotoga naphthophila RKU-10          ERILVVKTEDFLKEFGEF−−EGFMRVNFENFLNFLD−−QYG−−FFREREEAEYDETTKQVIPYVVIMD−−−−−−GDRVLITKRTTKQSEKRLHNLYSLGIGGHVREED−−−GAT−−−−−−−QREAFLKGLEREVNEEVDVSLR−−−E−−−−−−−−−−−−−−−LEFLGLI−−−NSSTT−−EVSRVHLGALFLGKGE−−−−−−FFSV−−KEKDLFEWELIKLEELEK−−−−−FSGVMEGWSKI          
fig|126740.6.peg.1472   Thermotoga sp. RQ2          ERILVVKTEDFLKEFGEF−−EGFMRVNFENFLNFLD−−QYG−−FFRERDEAEYDETTKQVIPYVVIMD−−−−−−GDRVLITKRTTKQSEKRLHNLYSLGIGGHVREED−−−GAT−−−−−−−PREAFLKGLEREVNEEVDVSLR−−−E−−−−−−−−−−−−−−−LEFLGLI−−−NSSTT−−EVSRVHLGALFLGRGK−−−−−−FFSV−−KEKDLFEWELIKLEELEK−−−−−FSGVMEGWSKI          
fig|243274.1.peg.1367   Thermotoga maritima MSB8          ERILVVKTEDFLKEFGEF−−EGFMRVNFEDFLNFLD−−QYG−−FFRERDEAEYDETTKQVIPYVVIMD−−−−−−GDRVLITKRTTKQSEKRLHNLYSLGIGGHVREGD−−−GAT−−−−−−−PREAFLKGLEREVNEEVDVSLR−−−E−−−−−−−−−−−−−−−LEFLGLI−−−NSSTT−−EVSRVHLGALFLGRGK−−−−−−FFSV−−KEKDLFEWELIKLEELEK−−−−−FSGVMEGWSKI          
fig|309803.4.peg.1196   Thermotoga neapolitana DSM 4359         DEKILVVKTEDVYREFGKF−−EGFLKTSLGEFLDFLK−−RYG−−FFRKRMEAEYDESTKQVIPYVVILD−−−−−−GNRVLLTKRTTKQSEKRLHNLYSLGIGGHVREED−−−GKT−−−−−−−PQEAFLKGLEREMNEEAEVELK−−−E−−−−−−−−−−−−−−−LEFLGLI−−−NSSST−−EVSRVHLGVLFAGKGR−−−−−−FVSM−−KEKDLFEWHLVEFDELGK−−−−−YLGVMEGWSKIAANVL     
fig|381764.6.peg.1626   Fervidobacterium nodosum Rt17-B1     MGNMDEKVLVIKTTDVERLCDGK−−TGVVKVPEDEFLKVL−−−KNG−−FFVERSIAEYDESTRQVIPYIVLKE−−−−−−NDEYIFFKRTTNQTEKRLHNLITLGVGGHLNVED−−−STD−−−−−−−PVECLKNGLWRELKEEVNVSVE−−−N−−−−−−−−−−−−−−−IEYIGLI−−−NEIEN−−PVSRVHVGVLYIAHVK−−−−−−YHGL−−AEPENFIE−−−IRSRKLSD−−−−−YLEEMEGWAKVT         
fig|484019.3.peg.551   Thermosipho africanus TCF52B         NEKVLVVPTEDVERLCNKR−−HGLIFVNEYDIISLIE−−NKG−−FFVDRNSAETDETIRQVIPYIVLRE−−−−−−ENKFLLFKRTSKQGEKRLHNQITIGVGGHINTDD−−−SLE−−−−−−−PLEAFKNGLIREINEEVDVDIK−−−S−−−−−−−−−−−−−−−LNYVGVI−−−NVVDT−−PVSRVHVGICYVADVK−−−−−−YKGL−−KEKDKFIE−−−LFTENPRE−−−−−YFEEMEGWSKTVVQSL     
fig|391009.9.peg.327   Thermosipho melanesiensis BI429          EKVLVVPTNKIQNICNNK−−TGLISVPEYDIISIIE−−KYG−−YFVDREKAENDETTRQVIPYIILRE−−−−−−NNKYLLFKRTTAQGEKRLHNKITIGVGGHINSTD−−−SID−−−−−−−PVKAFKKGMIREINEEVNVEIL−−−N−−−−−−−−−−−−−−−LNYIGVI−−−NVTDN−−PVSRVHVGLCYIADVK−−−−−−YFGL−−MEKEKFIE−−−LFTENPSK−−−−−YFEEMEGWSKVVVQSL     
fig|521045.3.peg.1670   Kosmotoga olearia TBF 19.5.1        MEENVLVVKTQALSDILTE−−−−EGVLKVSEEIIESKLR−−EFG−−EFLPRNAAEFDENYRQIIPYVVMMS−−−−−−EGKVLLLRRTTRQGEKRLHNKYSLGVGGHINDTD−−−ASS−−−−−−DLWETFKKGMEREINEEVEVEIK−−−E−−−−−−−−−−−−−−−LKYIGLI−−−NETST−−EVSRVHLGIAYVAEVE−−−−−−FFGL−−REEDMFEIQWIHPDELCK−−−−−KDWGLEGWSKLVLKEI     
fig|416591.4.peg.1553   Thermotoga lettingae TMO        MQEKILTVPATVVDQLTNMQ−−EGLIYVELRDIETAVK−−KYG−−VFVDRDIAESDERFRQVIPYVVVMN−−−−−−DDKILLLRRTDKQGEKRLHNKFSVGVGGHIRRED−−−GAD−−−−−−−PWCAFLNGMKREIDEEVKVDLL−−−D−−−−−−−−−−−−−−−LQYIGLI−−−NDLQS−−PVSRVHVGVAYIATAT−−−−−−FHGL−−NEPDMFEYWWKALNEIRV−−−−−DEKNLEGWSYLTI        
fig|403833.7.peg.1764   Petrotoga mobilis SJ95        MSEQILAIPTKKMDEKISSNN−−DNFFKIKFSDFVEIL−−−ESG−−NFYERNALENDYNYKQIIPYVVFRNF−−−−−QDEILVLKRTQNQGEKRLHNKISIGIGGHINKGD−−NGIT−−−−−−−MEQTFFNGMDREINEELWITNS−−YK−−−−−−−−−−−−−−−YVYKGII−−−NDNDE−−DVSKVHLGVLFVGFID−−−−−−SAKI−−KEEDNFESTWMKKEEIVN−−−−−LKDVNFEGWTKIALNNL     
fig|504728.6.peg.1475   Meiothermus ruber DSM 1279     MTRMEQVYVLPASVFPA−−−−AQ−−ASLIPLEAALLRRIE−−−QEG−−FFLKRPQAEEDPTHRQIIPYAVVRH−−−−−−RGRFFLMRRTKGGAEARLHNRYTLGVGGHINPED−−VGGN−−−−−−−−−−PVLDGLRRELLEEVGVRA−−−YT−−−−−−−−−−−−−−−AQPVGFI−−−VMADS−−PVSRVHAGVVFVVEAE−−−−−DEPRV−−MEAEKLEGRLASLEEVQQ−−−−−VYEGLEGWSKVVVDWL     
fig|243090.1.peg.4578   Pirellula sp. 1         EEHVLVIPATLIES−−IGHL−−EGFDRNVDRFLQPILASDEL−−SYRPRGAMELDPSFKQLIPYVVMQWTDPADGAVKWFQYTRGGGSGEKRLHAKRSIGVGGHISQED−−−AGG−−−−−−−EEDPYTIGMRRELEEEVTIGAP−−YV−−−−−−−−−−−−−−−DQREGLL−−−YDPSN−−EVGRVHLGVVHRFILE−−−−−−QPLVTSNEAELAEGQFVSVKQLRQ−−−−−EREHLETWSQLTLDAL     
fig|243090.15.peg.3953   Rhodopirellula baltica SH 1         EEHVLVIPATLIES−−IGHL−−EGFDRNVDRFLQPILASDEL−−SYRPRGAMELDPSFKQLIPYVVMQWTDPADGAVKWFQYTRGGGSGEKRLHAKRSIGVGGHISQED−−−AGG−−−−−−−EEDPYTIGMRRELEEEVTIGAP−−YV−−−−−−−−−−−−−−−DQREGLL−−−YDPSN−−EVGRVHLGVVHRFILE−−−−−−QPLVTSNEAELAEGQFVSVKQLRQ−−−−−EREHLETWSQLTLDAL     
fig|314230.3.peg.3297   Blastopirellula marina DSM 3645          EHILVVPTAEFRN−−LGYF−−QGFSPDAPRYLKHLLQPALI−−SFRPRPEMEEDPSFKQLIPYVIFEYVDADGEAWVFQYVRGKGQGESRLHSKRSVGVGGHISSED−−−AAEH−−−−LSGNPYEEGMRRELDEEVEIGCE−−YE−−−−−−−−−−−−−−−IECVGLI−−−NDDQN−−PVGQVHLGVVHRCRVV−−−−−−QPAVRPRESEIIEAGFVPVSQLLE−−−−−ELDRCETWSSICLQAL     
fig|530564.3.peg.3671   Pirellula staleyi DSM 6068          EHVLVVPRIVFQG−−LGHF−−QGFSGEVDRYLEGLLDPAVT−−SYRPRSAMEQDPSFKQLIPYVIFRYRDVAGSWHLFQYTRGKGQGEKRLHAKRSIGIGGHISSDD−−−AS−−−−−−−−CSNPYAEGMRRELAEEVNIDTP−−YT−−−−−−−−−−−−−−−ASLVGLI−−−NDDQS−−EVGKVHLGVVHFFDVT−−−−−−SPSVTPREEDLLDAGFRPLAEIQA−−−−−MAAEYETWSQICLEAL     
fig|521674.5.peg.3193   Planctomyces limnophilus DSM 3776        MEEHVLVVPTKIFHD−−LGHF−−EGFCAETDKYLAELLNPAHT−−RYEPRSAVETDPSLKQLIPYCIFTH−−−−−−GGEIFYYRRGSKGGEGRLHKKRSIGIGGHISSTD−−−PAG−−−−−−−GERRYGPAMEREIEEEVFLETG−−FK−−−−−−−−−−−−−−−ERCVGLI−−−NDDSS−−DVGRVHLGIVHVFELE−−−−−−AAKVRPREESILESGFAPPSQLVA−−−−−EIEDFETWSQICLKSL     
fig|344747.3.peg.1569   Planctomyces maris DSM 8797             MVVPTLLFHE−−VGYF−−QGFNDQVAPYLKTLFDPNYI−−SFRPRDTVEEDPSFKQLIPYCIFRH−−−−−−EGKIFYYTRGSKGGEQRLHSKRSIGIGGHISLED−−−DAK−−−−−−−EGSTYREGMQREIQEEVAMDTK−−YT−−−−−−−−−−−−−−−EACVGLI−−−NDDET−−EVGKVHLGIVHIFDLE−−−−−−LPKVLPREESIIETGFDSPEKLLQ−−−−−ELDQFETWSQICLKGL     
fig|349741.3.peg.2174   Akkermansia muciniphila ATCC BAA-835     SRYHGEQVLVVPRAAFEE−−AGYF−−QGHREGGDHYLNAFMKPGVA−−SFMDREAAENDPSHKQIIAYAIFCH−−−−−−QGRILHYTRGGSGGEARLHDKGSIGIGGHINPVD−−−RQSGH−−−−DDVSTYLAGVEREIREELVIDGN−−CT−−−−−−−−−−−−−−−QRVLGVI−−−NDDTN−−DVGAVHLGIVHLFELD−−−−−−TDRVRANEAALANLRFVSPEELSG−−−−−EMFEKLETWSQLALE       
fig|497964.5.peg.933   Chthoniobacter flavus Ellin428           MILVVRRALFDE−−LGAF−−QGLNFEIDRYLPALLARENN−−FFTPRPPAETDPSLKQIIPYVLLVH−−−−−−EGRVLHYVRGKKAGEQRLVAKGSIGIGGHMNDHD−−−EGLFA−−−−LDRAAYDAAVQREVGEELKLGAR−−YQ−−−−−−−−−−−−−−−NRAVALL−−−NDDSN−−DVGRVHLGVVHIFQLE−−−−−−TPDVQKGEAMITELQFLDRAQLAA−−−−−RRDSMETWSQICFDHL     
fig|240016.6.peg.3235   Verrucomicrobium spinosum DSM 4136              MIPRALFDE−−LGAF−−QGFQPEVDRYLEAILAPGAN−−FFLPRPGAEMDPTHKQIIPYAIFHH−−−−−−QGKYLVYTRGGKSGEKRLVAKRSIGIGGHINPHD−−−EREDS−−−−LAKTTYLNGVEREIEEELVLTGS−−HT−−−−−−−−−−−−−−−QQVIGLI−−−NDDSN−−EVGQVHLGVVHLFDLE−−−−−−SDQVTSNEDAIQDLQFLSLDELVA−−−−−GIENLETWSAICVRHL     
fig|589865.3.peg.1074   Desulfurivibrio alkaliphilus AHT2       KMAEEVFCLPRRELEQLFGGELPQGGFAGPEPERLLELPQ−−−−−−−RFIARGICEEDPSFKQLIPYQLFSF−−−−−−QQRFFVYRRGGGVGEGRLAGRLSVGVGGHINRED−−−ADA−−−GGLLTAAAYRQALLRERREELVNSDG−−VS−−−−−−−−−−−−−−−CRFVGWI−−−NDDDS−−PVGRVHLGAVHLGQMTDEQTRTALGIRAQGEDIHPEGWWSAAEIYE−−−−−QEERFEKWA            
fig|316056.16.peg.148   Rhodopseudomonas palustris BisB18          EEVLCAPEANFRD−−VLTF−−QGIDPDSASILKRILTSHEP−−TYIARTEAETRDDAKQFITYVLVQC−−−−−−GERLLFFRRSYLSRAAEFLRGSKCIGFGGHVSAAD−−−VDMWS−−−−REDYGLAACARRELAEEISLQDRSANQVANNRATIRLFQDVPLERLGIL−−−NDDSS−−EVGRRHVAVVYRAWISDWNVAKKLMKGDSSIKGISWIDLSKDTL−−−−−DIADFEYWSQLCLR       
fig|316056.14.peg.138   Rhodopseudomonas palustris BisB18          EEVLCAPEANFRD−−VLTF−−QGIDPDSASILKRILTSHEP−−TYIARTEAETRDDAKQFITYVLVQC−−−−−−GERLLFFRRSYLSRAAEFLRGSKCIGFGGHVSAAD−−−VDMWS−−−−REDYGLAACARRELAEEISLQDRSANQVANNRATIRLFQDVPLERLGIL−−−NDDSS−−EVGRRHVAVVYRAWISDWNVAKKLMKGDSSIKGISWIDLSKDTL−−−−−DIADFEYWSQLCLR       
fig|555779.3.peg.223   Desulfonatronospira thiodismutans ASO3-1                                                                           VFDD−−−−−−QDRLLLQKRS−−−LNKRVAPGRWDTSVGGHVDCGE−−−−−−−−−−−−−−−−SIETAMYREMQEELGIRPRD−−−−−−−−−−−−−−−−−−VQFAYKYIHSNDFES−−−−−−−−−−ELVYTYTCR−−−−−YDGQVEFNPEEIDAVKFWKTEEIEENLGNGTLSDNFE               
fig|58051.5.peg.767   Moritella sp. PE36                                                                                           YERSKSGGESRLHNLFSIGIGGHVDAVD−−−AVYDEKGVFQLTDTLRTGMYRELHEELGLTESDFLG−−−−−−−−−−−−−−−MTTIGYL−−−SKDVT−−PVDEVHLGIVLVAEVH−−−−−ADLVVTSKEDALNLAGFLTADELAK−−−−−−−−LNLESWSETVVAEL     
fig|177437.4.peg.2003   Desulfobacterium autotrophicum HRM2        HQEKVLCIKRELLPAPWVQK−−−KSVLNIDKNLFLQTCDQAGF−−EFKARGIIETDPSFKQIIPYIIIQT−−−−−−ADRELTAAYLRNGSEQRLHDLWSIGIGGHINLKD−−−CQTPS−−−−SFEQVLTTGMTRELDEELIKRPDNEC−−−−−−−−−−−−−−−PNFCGII−−−NEEET−−PVGSVHLGAVFTLKTC−−−−−−DPDRFSPGPELMDFTWKRTETLAQ−−−−−−−−LNLELWSRLALE       
fig|1220533.3.peg.1860   Bacillus subtilis QB928     MGKMDEMILVAPRDDVFKKESLTF−−QGVYSEDSRVAEIMAQIEAAY−−REMRRGDAEEDPRFKQPIPYVVIKR−−−−−−EDEVFLYERLAGGGESRLHNKLSLGFGGHMNAIE−−−GAA−−−−−−SFAEVLKLNTDRELEEELQINEEDKQA−−−−−−−−−−−−−−−IVTLGLI−−−NDDEN−−SVGKVHIGILSALQLK−−−−−PGAQVEVKEKEQIAGKWMKVSELKQ−−−−DDIYNRLETWSQFVVDIL     
fig|703612.3.peg.1505   Bacillus subtilis subsp. spizizenii ATCC 6633     MGKMDEMILVAPRDDVFKKESLTF−−QGVNSEDSKVAEIMAQIEAGY−−REMRRGDAEEDPHFKQPIPYVVIKR−−−−−−EDEVFLYERLAGGGESRLHNKLSLGFGGHMNSIE−−−GAA−−−−−−SFAEVLKLNTDRELDEELQINEEDKQA−−−−−−−−−−−−−−−IVTLGLI−−−NDDEN−−SVGKVHIGILSALQLK−−−−−PGSQVEVKEKEQIAGKWMKISELKQ−−−−DDIYNRLETWSQFVIDIL     
fig|1150475.3.peg.1743   Bacillus amyloliquefaciens subsp. plantarum UCMB5036     MNKMDEIILAAPRSDVFQNEMLTF−−QGVNSEDERIVNIMAQIEAHF−−FEIRRGDAEEDPRFKQPIPYVVIRR−−−−−−DDEVFVYERLAGGGESRLHNKLSLGFGGHMNPME−−−GAA−−−−−−SFSEVLKQNTDRELAEELYIREEDKQN−−−−−−−−−−−−−−−IVTLGLI−−−NDDEN−−DVGKVHIGILSALQLA−−−−−SAAQVEVKEKDQIAGRWMKLSELKE−−−−ENVYQRLEAWSQFVADIL     
fig|326423.3.peg.1729   Bacillus amyloliquefaciens FZB42     MNKMDEIILAAPRSDVFQNEMLTF−−QGVNSEDERIVNIMAQIEAHF−−FEIRRGDAEEDPRFKQPIPYVVIRR−−−−−−DDEVFVYERLAGGGESRLHNKLSLGFGGHMNPME−−−GAA−−−−−−SFSEVLKQNTDRELAEELYIREEDKQN−−−−−−−−−−−−−−−IVTLGLI−−−NDDEN−−DVGKVHIGILSALQLA−−−−−SAAQVEVKEKDQIAGRWMKLSELKE−−−−ENVYQRLEAWSQFVADIL     
fig|279010.5.peg.2670   Bacillus licheniformis ATCC 14580     MGKMDEMILVVPRENVFANETLTF−−QGVNSDGETIGKIMAHIERHF−−SEMRRGDAEEDPAFKQPIPYVVIKR−−−−−−EDEIFVYERLEGGGEARLHNKLSLGFGGHMNFAE−−−GL−−−−−−DFPDILKLNTDRELDEELLIEESAKEK−−−−−−−−−−−−−−−MVTLGLI−−−NDDEN−−SVGKVHIGILSALELK−−−−−PGAHVEVKEKEQIAGRWMKASDLKE−−−−KSVYDRLESWSQFVVDIL     
fig|536229.4.peg.169   Bacillus pumilus ATCC 7061     MGKMDEIILVAPRTRVFQNESLAF−−NGVNSEEKTINTIMKEIEEHF−−KQMRRGDAEENPDFKQPIPYVVIKR−−−−−−DDEVYVYERLQGGGETRLHHKLSLGFGGHMNFIE−−−GK−−−−−−NFAEILKENTDRELDEELSIQEEDKLE−−−−−−−−−−−−−−−MKTLGLI−−−NDDDN−−SVGRVHIGLLSALELS−−−−−PGAHVEVKETDQISGKWMKASDLKK−−−−PEYFDRLETWSQFVVNIL     
fig|315750.5.peg.1478   Bacillus pumilus SAFR-032     MGKMDEIILVAPRTRVFQNETLAF−−NGVNSEEETINTIMKEIEEHF−−EQMRRGDAEENPDFKQPIPYVVIKR−−−−−−EDEVYVYERLHGGGETRLHHKLSLGFGGHMNFIE−−−GK−−−−−−NFAEILKENTDRELDEELSIQEADKLE−−−−−−−−−−−−−−−MKTLGLI−−−NDDDN−−SVGRVHIGLLSALELS−−−−−PGAHVEVKETDQISGKWMKASDLKK−−−−PEYFDRLETWSQFVVNIL     
fig|66692.6.peg.3317   Bacillus clausii KSM-K16     MGKMDEMIVVAPRKHVFHNETLAF−−QGVVSEREQVATIMNRLNRHF−−SEMRRGNAEEDTTYKQPIPYVVIRR−−−−−−GKEIYSYERLSGGGEARLHNQLSIGFGGHMNAIM−−−SS−−−−−−−SFIEMLEANTHRELHEELIFDASKQKA−−−−−−−−−−−−−−−MKTIGLI−−−NDDAN−−EVGRVHLGILSVLDLE−−−−−EDTDVAIRETNQLAGRWVTLEELSA−−−−QPMYDRLESWSKFVVDIL     
fig|458233.11.peg.1446   Macrococcus caseolyticus JCSC5402     MNKFDEQIIVVDRETIFSHEKNHF−−NGFISMEDQRALEIYETLTKY−−EVKRRGDMEEDERYKQLISYCILENE−−−−−NDEILVYERLAGGGEGRLHGLSSIGIGGHMNRID−−−NAQ−−−−−−−IEDVLLENAGRELEEEVGVRDVSANA−−−−−−−−−−−−−−−LQLIGFI−−−NDDDT−−EVGRVHIGLVFKLKVA−−−−−−SSDVFVNETDTLKIDWKKEHTLMQ−−−−−−−NAEYESWSRLIIESI     
fig|629742.3.peg.1061   Staphylococcus hominis SK119     MSKFDEQIIVVSRELLFNNEKNAF−−NGFLSKNDGQGEEIFNTFKNY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−NDEILVYQRLSGGGEERLHGQSSVGVGGHMNNVV−−−GAD−−−−−−SINEVLRVNAQRELNEEVGLSEDRSQN−−−−−−−−−−−−−−−IEYIGFI−−−NDDTN−−AVGKVHIGVVFKIKVK−−−−−−SSDVEVRETDTLKINWVSQDEIND−−−−−−−LNHFESWSALILKDL     
fig|279808.8.peg.1229   Staphylococcus haemolyticus JCSC1435     MSKYDEQIIVVPRDILFEQESNAF−−NGFLTKNDPQGEAIFNTFSNY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−KNEILVYKRLSGGGESRLHGQSSIGVGGHMNDVI−−−GAN−−−−−−SVNEVLRVNAQRELEEEVGLLESNSQN−−−−−−−−−−−−−−−LEYIGFI−−−NDDTN−−DVGKVHIGVVFKIKVN−−−−−−SNDIEVRETDTLKIQWLEKERIDN−−−−−−−YDEFETWSALILKDL     
fig|396513.4.peg.1282   Staphylococcus carnosus subsp. carnosus TM300     MSKFDEKIIVVPREIVFNHEKNAF−−NGFLSKNVPMGEKIFDTLDQY−−EVKRRGDMEEDPAYKQLISYCLLENE−−−−−NGETLVYERLSGGGEERLHGQSSIGVGGHMNDVL−−−DAQ−−−−−−NVNEVLRVNAQRELEEEIGLSSSKTQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDTN−−EVGEVHLGIVFKIRVD−−−−−−TENVEVKETDTLKIKWMHQGRIDN−−−−−−−YDDFETWSALILKAF     
fig|1131257.3.peg.1170   Staphylococcus saprophyticus subsp. saprophyticus KACC 16562     MSKFDEMITVVPRTILFDNEKNKF−−NGFLDKNTTKGQDIFDTLSKY−−EIKRRGDMEEDPSYKQLISYCILENE−−−−−HDEILVYERLSGGGEARLHGQSSIGVGGHMNDVK−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSDSKSQN−−−−−−−−−−−−−−−LAYIGFI−−−NDDTN−−EVGEVHLGVVFKINVN−−−−−−SNDVESKETDTLRIKWVDQSKIDN−−−−−−−YDEFESWSALILQA      
fig|883164.3.peg.255   Staphylococcus lugdunensis ACS-027-V-Sch2     MSKFDEQIIVVPRSILFDNNKNAF−−NGFLTKHGNQGEEIFNKLDAY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−NGEILVYERLSGGGEQRLHGQSSIGVGGHMNDVV−−−GAD−−−−−−NVNEVLRVNAQRELEEEVGLSSDKSQN−−−−−−−−−−−−−−−MQYIGFI−−−NDDNN−−EVGRVHIGVVFKITVN−−−−−−SNDVEAKETDTLRIKWMEQGKIDN−−−−−−−YDDFETWSALILQDL     
fig|904335.3.peg.1300   Staphylococcus epidermidis VCU117     MSKFDEQIIVVNRDILFNKDKNAF−−NGFLHKNNFKGKEIFSALSKY−−EVKRRGDMEDDPSFKQLISYCLLENE−−−−−KGEILIYERLSGGGEERLHGQSSIGVGGHMNDVV−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLSNNKSQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDDN−−DVGKVHMGVVFKITVH−−−−−−SNDVEAKETDTLKIKWIEQGDIQS−−−−−−−YEDFETWSALILQDI     
fig|904323.3.peg.1362   Staphylococcus epidermidis VCU057     MSKFDEQIIVVNRDILFNKDKNAF−−NGFLHKNNFKGKEIFSALSKY−−EVKRRGDMEDDPSFKQLISYCLLENE−−−−−KGEILIYERLSGGGEERLHGQSSIGVGGHMNDVV−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLSYNKSQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDDN−−DVGKVHMGVVFKITVH−−−−−−SNDVEAKETDTLKIKWIEQGDIQS−−−−−−−YEDFETWSALILQDI     
fig|904344.3.peg.571   Staphylococcus epidermidis VCU128     MSKFDEQIIVVNRDILFNKDKNAF−−NGFLHKNNFKGKEIFSALSKY−−EVKRRGDMEDDPSFKQLISYCLLENE−−−−−KGEILVYERLSGGGEERLHGQSSIGVGGHMNDVT−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLSNNKSQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDDN−−DVGKVHMGVVFKITVQ−−−−−−SNDVEAKETDTLKIKWIEQGDIHS−−−−−−−YEDFETWSALILQDI     
fig|553212.3.peg.1884   Staphylococcus capitis SK14     MSKFDEQIIVVPRKVLFNDEKNAF−−NGFLHKNNIKGKDIFNALNEY−−EVKRRGDMEEDSTFKQLISYCLLENE−−−−−KGEILVYERLSGGGEERLHGQSSIGVGGHMNDVM−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLAKEDSQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDNN−−EVGKVHMGIVFKITVS−−−−−−TTDVEAKETDTLRIKWVEKGSIES−−−−−−−YDDFETWSALILQDL     
fig|525378.3.peg.868   Staphylococcus epidermidis M23864:W1     MSKFDEQIIVVPRSVLFNDDKNAF−−NGFLHKNNIKGKDIFNALSEY−−EVKRRGDMEEDPTFKQLISYCLLENE−−−−−KGEILVYERLSGGGEERLHGQSSIGVGGHMNDVV−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLASEDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDTN−−EVGKVHMGVVFKITVH−−−−−−TSDVEAKETDTLRIKWVEKGSIES−−−−−−−YDDFETWSALILQDL     
fig|596319.3.peg.1673   Staphylococcus warneri L37603     MSKFDEQIIVVPRATLFDNEKNAF−−NGFLSKNDEKGSNIFNALSQY−−DVKRRGDMEEDPEFKQLISYCLLENQ−−−−−SGEILVYERLSGGGEERLHGQSSIGVGGHMNDVV−−−GAD−−−−−−SINEVLRVNAQRELEEEVGLSAEDSQN−−−−−−−−−−−−−−−MEYLGFI−−−NDDNN−−EVGKVHMGVVFKITVS−−−−−−SNDVESKETDTLRIKWIEKGKIES−−−−−−−YDDFETWSALILQDL     
fig|273036.6.peg.1634   Staphylococcus aureus RF122     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKPEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−YGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDTLRIKWIEKGNIES−−−−−−−YDDFETWSALILQDL     
fig|359787.3.peg.353   Staphylococcus aureus subsp. aureus JH1     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKPEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−T                                                   
fig|548475.3.peg.662   Staphylococcus aureus subsp. aureus TCH70     MSKFDEQIIVVPREIIFNNEKNNF−−NGFLNKNKPEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDTLRIKWVEKGNIES−−−−−−−YDDFETWSALILQDL     
fig|553567.3.peg.1299   Staphylococcus aureus A5948     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKPEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCILENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDALRIKWVEKGNIES−−−−−−−YDDFETWSALILQDL     
fig|426430.8.peg.1703   Staphylococcus aureus subsp. aureus str. Newman     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKPEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDTLRIKWVEKGNIES−−−−−−−YDDFETWSALILQDL     
fig|585147.3.peg.1281   Staphylococcus aureus subsp. aureus A017934/97     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKLEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVDLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDTLRIKWVEKGNIES−−−−−−−YDDFETWSALILQDL     
fig|585161.3.peg.1395   Staphylococcus aureus subsp. aureus WW2703/97     MSKFDEQIIVVPREIIFNNEKNTF−−NGFLNKNKLEGQNIFDALSQY−−EVKRRGDMEEDPSYKQLISYCLLENE−−−−−HGEILVYERLSGGGEARLHGQSSIGVGGHMNDVP−−−GAE−−−−−−SINEVLRVNAQRELEEEVGLSEQDSQN−−−−−−−−−−−−−−−MEYIGFI−−−NDDNN−−EVGKVHIGVVFKITVS−−−−−−TNDVEAKETDTLRIKWVEKGNIES−−−−−−−YDDFETWSALILQDL