(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00014693

fig|1053205.3.peg.4595   Bacillus cereus HuA3-9                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053246.3.peg.5484   Bacillus cereus VDM019                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526972.3.peg.5696   Bacillus cereus AH621                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526997.3.peg.5183   Bacillus mycoides DSM 2048                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526990.3.peg.1076   Bacillus cereus AH603                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|315730.11.peg.5391   Bacillus weihenstephanensis KBAB4                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDVKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526976.3.peg.1574   Bacillus cereus BDRD-ST196                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDVKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEDELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053249.3.peg.5654   Bacillus cereus VDM053                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526971.3.peg.5649   Bacillus cereus MM3                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526993.3.peg.2804   Bacillus cereus AH1272                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSQEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526992.3.peg.2510   Bacillus cereus AH1271                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFRF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|281309.8.peg.4923   Bacillus thuringiensis serovar konkukian str. 97-27                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCSSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053220.3.peg.5661   Bacillus cereus MSX-A1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1218175.3.peg.4886   Bacillus thuringiensis HD-771                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527019.3.peg.6355   Bacillus thuringiensis IBL 200                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527020.3.peg.2207   Bacillus thuringiensis IBL 4222                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527026.3.peg.2240   Bacillus thuringiensis serovar sotto str. T04001                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053214.3.peg.970   Bacillus cereus IS845/00                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053228.3.peg.5432   Bacillus cereus VD102                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1286404.3.peg.5033   Bacillus thuringiensis serovar thuringiensis str. IS5056                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|222523.6.peg.4838   Bacillus cereus ATCC 10987                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|280355.4.peg.4535   Bacillus anthracis str. A1055                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|288681.15.peg.4919   Bacillus cereus E33L                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|347495.3.peg.4794   Bacillus cereus F837/76                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|361100.6.peg.4773   Bacillus cereus Q1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|405917.4.peg.1060   Bacillus cereus W                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|451709.4.peg.1534   Bacillus cereus 03BB108                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526973.3.peg.844   Bacillus cereus m1293                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526977.3.peg.4697   Bacillus cereus ATCC 4342                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527022.3.peg.1203   Bacillus thuringiensis serovar monterrey BGSC 4AJ1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527024.3.peg.672   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527028.3.peg.20   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527029.3.peg.5771   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527031.3.peg.242   Bacillus thuringiensis serovar berliner ATCC 10792                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|527032.3.peg.481   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|568206.3.peg.5426   Bacillus anthracis str. CDC 684                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|526982.3.peg.273   Bacillus cereus Rock1-15                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEQKI           
fig|1053182.3.peg.633   Bacillus cereus BAG3O-2                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053223.3.peg.4682   Bacillus cereus VD014                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053225.3.peg.4251   Bacillus cereus VD045                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053233.3.peg.3141   Bacillus cereus VD133                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1053238.3.peg.4542   Bacillus cereus VD154                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|1279365.3.peg.5212   Bacillus thuringiensis serovar kurstaki str. HD73                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEELSHYSN−−−−−−−−−−−−−ATTD−−−−−−−−−−−−−−−−−−−IEFKF−−−PF−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WGELWGVASRTDFDLKRHMEHSNEDFNYID−−−−−−−−PQTNERY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VPYCIEPSLGADRVTLAFLCDAYEEEQL−−−EN−−DSRTVLRFHPALAPYK−−AAILPL−−−−−−S−−−−−−KK−−LSEGATEVFAEL−−−−−−−AKD−−FM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDFDET−−−GSIGKRYRRQDEIGTPFCITYDFDSV−−−−−−EDK−−−−−−AVTVRDRDTME−−−−−−−QV−−−−−−−−−−−−−−−−−−RM−−−−−−−−−PISELKGFLEKKI           
fig|405532.5.peg.4871   Bacillus cereus B4264                                                                                                                         ILMNPKTWIASG−−−HVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIE−−MVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WFAFWRETCKNWLLSLGM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SMRLRDHGEEEL