(in new window)

SEED user:
Focus protein ID:

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      

Alignment 00004722

fig|243272.4.peg.49   Mycoplasma arthritidis 158L3-1     IEERSKFIELYEKFGALLAQSQKQALYLHLFEDLSLAEISQELAMTRSGVYDAIKKGKVKL                
fig|234267.13.peg.2667   Solibacter usitatus Ellin6076                      LSEKQRTVFLLHFLEEMSAAEIEAATGISRAAIKVHLFRAVHAI−−−REKLG        
fig|483218.5.peg.599   Bacteroides pectinophilus ATCC 43243                      LPPKYRDVIFLYYYEELSTAEIAGILGIMQTGVRSRLKRARDILKKEADNYE        
fig|358681.3.peg.5070   Brevibacillus brevis NBRC 100599                  YIQSLAPKYRQVILLHYYEDLSIAEVADILSVSQEVVRTRLHRARKQLKETMSK          
fig|269798.16.peg.533   Cytophaga hutchinsonii ATCC 33406      LEQKEEAEILLSVIEKLPERQKAVFVLYQFEDMSYKEIASTLEISVSAVDSLMSRAKKQLRE              
fig|316055.16.peg.798   Rhodopseudomonas palustris BisA53          EVSLLLEAAMQRLPEQQRIAMILSYHQDMSNGEIAEVMETTVAAVESLLKRGRQQLRDL             
fig|269796.9.peg.2644   Rhodospirillum rubrum ATCC 11170             DRVRQALRFLSEPQRMAITLYYNEDLTAAEVATVMDLSLNAVESLLKRGRHKLREL             
fig|1085.1.peg.186   Rhodospirillum rubrum             DRVRQALRFLSEPQRMAITLYYNEDLTAAEVATVMDLSLNAVESLLKRGRHKLREL             
fig|436113.7.peg.426   Mycoplasma mycoides subsp. capri str. GM12 (Prj:39245)     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFNLETKLHLKQK    
fig|865867.3.peg.532   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale     LEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLEKKLHLKQK    
fig|572547.3.peg.570   Aminobacterium colombiense DSM 12261     LEDRIYLNQLYDLYGALLTEKQRNAYEHHEFSDLSITETAERLDTTRQAAFDLISRA                    
fig|451757.5.peg.1511   Clostridium perfringens NCTC 8239                              MTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKLKLSKKIDKR
fig|635013.3.peg.2203   Thermincola sp. JR                              MEMYYNNDLSLGEIAEEHSVSRQAVYDIIKRGEKILEEYENKLGLVKKFNKE
fig|445972.6.peg.780   Anaerotruncus colihominis DSM 17241     MAKNLEISVLLDFYGEMLTEKQRDVVELYYNEDLSLSEIAAHSQITRQGVRDSIKRAEGI                 
fig|698948.3.peg.1433   Thermoanaerobacterium thermosaccharolyticum M0795       DFVEMNVLFDFYGSLLTGKQMDIFKMYYMDDYSLGEISQELNISRQGVYDSLKRAESVLRFYEEKLGLVKKY   
fig|1496.1.peg.39   Clostridium difficile 630                             IVALYYEEDYSLGEISENLNVSRQGVYDTLKRSEKILRDYEEKLHLVSKIQEQ
fig|335541.7.peg.1608   Syntrophomonas wolfei subsp. wolfei str. Goettingen     LEKTEHMIMLKDFYGPLLTLKQQDLMSLYYEDDWSLSEIAENRGTSRQAVYDVLKRAETALQEYEERLGLVDKFI  
fig|521098.5.peg.1308   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     MRDVTRVGDLYAFYEPLLTERQRQIVELYHFEDMSLGEIAEILSISRQAVHDQLRRVEDQLESYEAALHLRE     
fig|521098.4.peg.2804   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     MRDVTRVGDLYAFYEPLLTERQRQIVELYHFEDMSLGEIAEILSISRQAVHDQLRRVEDQLESYEAALHLRE     
fig|393480.8.peg.1660   Fusobacterium nucleatum subsp. polymorphum ATCC 10953     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGVALLYDYEDKLKFYQ     
fig|190304.8.peg.1956   Fusobacterium nucleatum subsp. nucleatum ATCC 25586     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGVALLYDYEDKLKFYQ     
fig|469602.7.peg.2009   Fusobacterium nucleatum subsp. vincentii 3_1_27     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGMALLYDYESKLKFYQ     
fig|469606.8.peg.1558   Fusobacterium nucleatum subsp. vincentii 4_1_13     LDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGMALLYDYESKLKFYQ     
fig|469603.7.peg.1573   Fusobacterium nucleatum subsp. animalis 3_1_33     LDKFVEIANLFEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGIALLYDYEDKLKFYQ     
fig|457403.8.peg.1801   Fusobacterium nucleatum subsp. animalis 11_3_2     LDKFVEIANLFEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGIALLYDYEDKLKFYQ     
fig|550748.3.peg.124   Ureaplasma urealyticum serovar 4 str. ATCC 27816           MIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEVSKSAISDCLNKVCDQLLKYEQALLIYEKNKKR
fig|342451.11.peg.1535   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     LIKTIRMNYLFDFYQALLTKKQRNYLELFYLQDYSLSEIANTFDVSRQAVYDNIRRTGDLVEDYEEKLGLYRNFEQR
fig|525378.3.peg.430   Staphylococcus epidermidis M23864:W1     LVKTLRMNYLFDFYQSLLTQKQRNYLELFYLQDYSLSEIADTFEVSRQAVYDN