(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009303

fig|273036.6.peg.1061   Staphylococcus aureus RF122     MRNVKQITTKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTSSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLQGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLVAKKDLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNKDKLKKDIDDKKDSQKSDIKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTVKKVENDHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYILFAAGIVLATILLISAHLYSRKRGNQV
fig|1213730.3.peg.2044   Staphylococcus aureus M0877     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTSSIFDEKIKENKALDLLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGKIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLVEKKDLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDIKERRTSLFTEKGLNDIPVQKDKVQQNSNKKIENERPKASSTLRVENSSPTVKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
fig|585155.3.peg.1304   Staphylococcus aureus subsp. aureus H19     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTSSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKALAEKKDLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDIKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASDTLKVENSSPTAKKVENNHKEQQKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
fig|1169271.3.peg.2070   Staphylococcus aureus M1256     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTSSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKDLDNKEMLYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDIKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTVKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAVGIVLATILLISAHLYSRKRGNQV
fig|450394.6.peg.322   Staphylococcus aureus subsp. aureus USA300_TCH959     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTVKKVENDHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYILFAAGIVLATILLISAHLYSRKRGNQV
fig|282459.1.peg.1057   Staphylococcus aureus subsp. aureus MSSA476     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTVKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYILFAAGIVLATILLISAHLYSRKRGNQV
fig|548474.3.peg.1184   Staphylococcus aureus subsp. aureus TCH130     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPLAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQKLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYILFAAGIVLATILLISAHLYSRKRGNQV
fig|546343.3.peg.484   Staphylococcus aureus subsp. aureus str. JKD6009     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKYKKGKEK                                                                   
fig|1158527.3.peg.215   Staphylococcus aureus M0374     MRNVKQIATKSIIAIISLCILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
fig|426430.8.peg.1140   Staphylococcus aureus subsp. aureus str. Newman     MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDEKIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQNDKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQHDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQQDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALPAFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV