(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020317

fig|681288.4.peg.2023   Staphylococcus aureus subsp. aureus ED98     MYYEIGEEHVKPIKVDGFKFFVHAIREVNGVAIKVNDIDRREVYNIVVTDESGLQIAMDNINAAIYEWIEHNTDEQERIINMIMKW
fig|359787.11.peg.2129   Staphylococcus aureus subsp. aureus JH1     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|359787.11.peg.359   Staphylococcus aureus subsp. aureus JH1     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|1116218.3.peg.2750   Staphylococcus aureus subsp. aureus VRS5     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|1116223.3.peg.1966   Staphylococcus aureus subsp. aureus VRS10     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|1157027.3.peg.2559   Staphylococcus aureus M0391     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|1213725.3.peg.1933   Staphylococcus aureus M0695     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|553577.3.peg.2882   Staphylococcus aureus A8796     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|553583.3.peg.586   Staphylococcus aureus A9635     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|553577.3.peg.2910   Staphylococcus aureus A8796     MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLI      
fig|426430.8.peg.1086   Staphylococcus aureus subsp. aureus str. Newman     MYYKAGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW
fig|451515.3.peg.2098   Staphylococcus aureus subsp. aureus USA300_FPR3757     MYYKTGDVCRKIINVDGFDFQLRVKKRAYSVEMVVLDHEGNSIDGLLVSDENDLYTALDILKQSVYEWIENNTDEQDKLMNLVMKW
fig|553567.3.peg.1861   Staphylococcus aureus A5948     MYYKTGDVCRKIINVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSVYEWIENNTDEQDKLMNLVMKW
fig|426430.8.peg.2093   Staphylococcus aureus subsp. aureus str. Newman     MYYKTGDVCQKIINVDGFDFRLRVKKRAYSVEIVVLDHEGNSIDGILVSDENDLYTALDILKQSIYEWIENNTDEQDKLMNLVMKW
fig|553577.3.peg.2832   Staphylococcus aureus A8796     MYYKTGDVCQKIINVDGFDFRLRVKKRAYSVEIVVLDHEGNSIDGILVSDENDLYTALDILKQSIYEWIENNTDEQDKLMNLVMKW
fig|904774.3.peg.2466   Staphylococcus aureus subsp. aureus 21345     MYYKTGDVCQKIINVDGFDFRLRVKKRAYSVEIVVLDHEGNSIDGILVSDENDLYTALDILKQSIYEWIENNTDEQDKLMNLVMKW
fig|282459.5.peg.942   Staphylococcus aureus subsp. aureus MSSA476     MYYKTGDVCQKIINVDGFDFRLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQTIYEWIEFNTDEQDKLINLIMKW
fig|548474.3.peg.2478   Staphylococcus aureus subsp. aureus TCH130     MYYKTGDVCQKIINVDGFDFRLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDKLINLIMKW
fig|585152.3.peg.1827   Staphylococcus aureus subsp. aureus D139     MYYKTGDVCQKIINVDSFDFRLRVKKRAYSVEIVVLDPEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMRW
fig|282459.5.peg.1987   Staphylococcus aureus subsp. aureus MSSA476     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|904739.3.peg.1865   Staphylococcus aureus subsp. aureus 21236     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|904760.3.peg.895   Staphylococcus aureus subsp. aureus 21310     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|904781.3.peg.845   Staphylococcus aureus subsp. aureus IS-105     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|93061.3.peg.2100   Staphylococcus aureus subsp. aureus NCTC 8325     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|644279.4.peg.2143   Staphylococcus aureus subsp. aureus 132     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDSINITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW
fig|452948.4.peg.2746   Staphylococcus aureus 930918-3     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDEQDRLINLVMKW
fig|585152.3.peg.1964   Staphylococcus aureus subsp. aureus D139     MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDEQDRLINLVMKW
fig|1157027.3.peg.1654   Staphylococcus aureus M0391     MYYEIGEVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|1116218.3.peg.2763   Staphylococcus aureus subsp. aureus VRS5                                     MNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|585155.3.peg.2602   Staphylococcus aureus subsp. aureus H19                                     MNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|1116223.3.peg.1017   Staphylococcus aureus subsp. aureus VRS10     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|553577.3.peg.2773   Staphylococcus aureus A8796     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|553577.3.peg.2916   Staphylococcus aureus A8796     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|681288.4.peg.832   Staphylococcus aureus subsp. aureus ED98     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW
fig|553577.3.peg.2988   Staphylococcus aureus A8796     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEENADDYDRLINLV   
fig|553581.3.peg.1139   Staphylococcus aureus A9299     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIY                    
fig|452948.4.peg.2800   Staphylococcus aureus 930918-3     MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDGINITNENDLYTALDILNQSIYEWIEE               
fig|1213725.3.peg.1921   Staphylococcus aureus M0695     MYYKIGEIKNKIISFNGFEFKVSVMKRHDGISIQIKDMNNVPLKSFHVIDLSELYIATDAMRDVINEWIEENTDEQDRLINLVMKW
fig|585161.3.peg.1833   Staphylococcus aureus subsp. aureus WW2703/97     MYYKIGEIKNKIISFNGFEFKVSVMKRHDGISIQIKDMNNVPLKSFHVIDLSELYIATDAMRDVINEWIEENTDEQDRLINLVMKW
fig|93061.3.peg.1959   Staphylococcus aureus subsp. aureus NCTC 8325     MYYKIGEIKNKIISFNGFEFKVSVMKRHDGISIQIKDMNNVPLKSFHVIDLSELYIATDAMRDVINEWIENNTDEQDKLINLVMKW
fig|904774.3.peg.1457   Staphylococcus aureus subsp. aureus 21345     MYYKIGEIKNKIISFNGFEFKVSVMKRHDGISIQIKDMNNVPLKSFHVIDLSELYIATDAMRDVINEWIENNTDEQDKLINLVMKW
fig|451515.3.peg.1560   Staphylococcus aureus subsp. aureus USA300_FPR3757     MYYKFGEIKNKIISFNGFEFKVSAMKKHDGISIQIKDMNNIPLKSFHVVDLSELYFATDAMRDVINEWIEENTDEQDRLINLVMKW
fig|452948.4.peg.2646   Staphylococcus aureus 930918-3     MYYKFGEIKNKIISFNGFEFKVSAMKKHDGISIQIKDMNNIPLKSFHVVDLSELYFATDAMRDVINEWIEENTDEQDRLINLVMKW
fig|158878.14.peg.2059   Staphylococcus aureus subsp. aureus Mu50     MYYKFGEIKNKIISFNGFEFKVSAMKKHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDAMRDVINEWIEENTDERDRLINLVMRW
fig|904781.3.peg.415   Staphylococcus aureus subsp. aureus IS-105     MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDAMHDVINEWIEENTDEQDRLINLVMKW
fig|93062.19.peg.324   Staphylococcus aureus subsp. aureus COL     MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDAMHDVINEWIEENTDEQDRLINLVMKW
fig|904760.3.peg.544   Staphylococcus aureus subsp. aureus 21310     MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFYVVDLSELYIAMDAMHDVINEWIEENTDEQDRLINLVMKW
fig|585159.3.peg.2106   Staphylococcus aureus subsp. aureus M899                             MKRHDGISIQVKDMNNVPLKSFYVVDLSELYIAMDAMHDVINEWIEENTDEQDRLINLVMKW
fig|904739.3.peg.1547   Staphylococcus aureus subsp. aureus 21236     MYYEIGDIIRKNIHVNGFDFKLSILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENADEQDRLINLVMKW
fig|1116223.3.peg.1834   Staphylococcus aureus subsp. aureus VRS10     MYYEIGDIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|158878.14.peg.887   Staphylococcus aureus subsp. aureus Mu50     MYYEIGDIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|553583.3.peg.606   Staphylococcus aureus A9635     MYYEIGDIICKNIHVNGFDFKLFILKGHMGISIQVKDMNNIPIKHAYVVDENDLDMASDLFNQATDEWIEENTDEQDRLINLVMRW
fig|585159.3.peg.2062   Staphylococcus aureus subsp. aureus M899     MYYEIGDIIHKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMKW
fig|1157018.3.peg.1379   Staphylococcus aureus M0239     MYYEIGDIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMKW
fig|273036.3.peg.1691   Staphylococcus aureus RF122     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVADENDLDMASELFNQAIDEWIEENTDEQDRLINLVMKW
fig|426430.8.peg.1961   Staphylococcus aureus subsp. aureus str. Newman     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMKW
fig|426430.8.peg.292   Staphylococcus aureus subsp. aureus str. Newman     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMKW
fig|644279.4.peg.1261   Staphylococcus aureus subsp. aureus 132     MYYEIGEIIRKNIHVNGFDFKLLILKGHMGISIQVKDMNNIPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|1116218.3.peg.766   Staphylococcus aureus subsp. aureus VRS5     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|1116223.3.peg.795   Staphylococcus aureus subsp. aureus VRS10     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|359787.11.peg.916   Staphylococcus aureus subsp. aureus JH1     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|553577.3.peg.1364   Staphylococcus aureus A8796     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|553596.3.peg.1752   Staphylococcus aureus A9781     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|585155.3.peg.2451   Staphylococcus aureus subsp. aureus H19     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW
fig|553596.3.peg.2725   Staphylococcus aureus A9781     MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHVYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMRW