(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020540

fig|979211.3.peg.2325   Staphylococcus epidermidis NIHLM023     MIHIQNFITTTIQLNIYLILVIGLLYLIIHYYRYKGFNAFLDIYLNYIPVLTHEFGHVLFNKLVGGKAKDLVIVTSPRERNVTSQQGYAITQSKGYLGQFITTIGGYLMPPLMFLTGLVSIHYQYPSIFITIYLLIFIYYFFITSRKLSPLIVIILISSLLYLVFRQDHQWFIYDIVTLSYHFILGVLLGEILQSSWTIFRLTFQRPKPSWDGSALTEITRVPTFIFSLVWILFNFYTVYLLIKYTIL
fig|904329.3.peg.532   Staphylococcus epidermidis VCU107     MIYLQNFITTTIQLNIYLILVIGLLYVIIHYYRNKGVNAFLDIYLNYIPVLTHEFGHVLFNKLAGGKAKDLVIVTSPRERKVTSQQGYAITQSKGYLGQFITTIGGYLMPPLMFLTGLVSIHYQYPSIFITIYLFIFIYYFFITSRKLSPLIVIILISSLLYLVFKQDHQWFIYDIVTLSYHFILGVLLGEILQSSWTIFRLTFQRPKPSWDGSALTKVTRVPTFIFSLVWILFNLYTVYLLIKYTIL
fig|904789.3.peg.2231   Staphylococcus aureus subsp. aureus IS-250     MIYLQNFITTTIQLNIYLILVIGLLYVIIHYYRNKGVNAFLDIYLNYIPVLTHEFGHVLFNKLAGGKAKDLVIVTSPRERKVTSQQGYAITQSKGYLGQFITTIGGYLMPPLMFLTGLVSIHYQYPSIFITIYLFIFIYYLFITSRKLSPLIVIILISSLLYLVFKQDHQWFIYDIVTLSYHFILGVLLGEILQSSWTIFRLTFQRPKPSWDGSALTKVTRVPTFIFSLVWILFNLYTVYLLIKYTIL
fig|553212.3.peg.725   Staphylococcus capitis SK14     MSYLENFFTTVIHLNIYLIIAIGIIYIFIHQNRHNGIIRFLDVYLNYIPVLTHEFGHVLFNRLAGGRAKDLVIVTSPTERQTTLQQGYAITQSKGYLDQFITTIGGYLMPPIMFLIGLVAAHFEQPSIFLVTYLLIFIYFLILTSRKLSPIIVILLISILLYFLVQHNHTMMVYDIVSLSYHLILGVLLGEIIQSSWTIFNLTFQRPKPSWDGSALTDITKVPTIIYSTIWIAFNLYTIYLLIKYTIL
fig|525378.3.peg.1088   Staphylococcus epidermidis M23864:W1     MTYLENFFTTVIHLNIYLIILISIVYIVIHQHRHKSINQFLDVYLNYIPVLTHEFGHVLFNRLAGGRAKDLVIVTSPKERQSTLQQGYAITQSRSYLGQFITTIGGYLMPPIMFLIGLVAAHYQHPSIFLVSYLFIFIYFLILTSRKLSPIIVILLIGILLYFLFKHDNQMIMYDIVSLSYHFILGVLLGEILQSSWTIFNLTFQRPKPSWDGSALTEITRVPTVIYSVLWIAFNLYTVYLLIKYTIL
fig|596319.3.peg.943   Staphylococcus warneri L37603     MTQFESFLTTHIHLNMYIILVISIIYIIVHQNRYKSYYRYFAIILNYIPVLTHEFGHVLFNKLSGGHAKDLVIVTRPSEREATLQQGYAITQSKSYLGQWFTTLGGYIMPPMMLWIGIITIFYNHPSFFILLYLGIFIYFLILTSRKLSPIIIIIAMTMLLYFLFQSDDLLVIHQIVSSSYHFILGVLLGEVLQSSWTIFRLTFQRPKQSWDGSTLTDISKVPTVIYSTIWITINLYTVYILIKLLLF
fig|279808.8.peg.2228   Staphylococcus haemolyticus JCSC1435     MVYLENFFTTTINLNIYLICIIAIIYIMIHQNRHRQFNQYLDVYLNYIPVLTHEFGHVLFNKISGGRAKDLVIVTRPSERLQTMQQGYAITQSKGLIGQFITTLGGYIMPPLMLLIGLSAAYYGHPSLFLSAYIIIFIYFLILTSRKLSPIIVLILFIALLYFLVQHDNQLLFYYLVTFIYHLILGVLLGEVLQSSWTIFKLTFQRPIPSWDGRTLTELTRIPTFLFSTLWIAINIFTIYLMLIFTI 
fig|342451.11.peg.2077   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MTKIQAFFSSTIQLNLIWVLIIALIYIIIHTYRYKSVNQILDIYLNYIPVLTHEFGHILFNKISGGKAKDLVIVAKPSERIETSQQGFAITQSKSSLGQAITTFGGYIMPPLMLLLGFLALENQYPSLFITAYLIIFIYFLALTSRKLVPILIVLLLIALLYFLFQSDNQQMMLYIVSISYHFILGVLLGEVLQSSWTIFKLTFSLQNVSWDGTTLKELTHLPTALFSLIWIAINLFTIYHLLQ    
fig|629742.3.peg.1211   Staphylococcus hominis SK119     MDYLQQFLTTTVILNIYLVIIIAISYIIIHQNRHCSFNQYLDIYLNYIPVLTHEMGHILFNKLSGGHAKDLVIVVHPSERKETLQQGYAITQSKSVTGQCITTLGGYVMPPIMLMIGFWTIHFNYPSLFLILYSLIFMYYLILTSRKLSPIIVLIILISLLYFLLQGNNQFMIFYIVVLLCHLILGVLLGEVLQSSWTIILLTFQRVKTHWDGNTLAELTHLPTLFYSLFWIMINGFSLYLIYKFMI 
fig|883164.3.peg.2260   Staphylococcus lugdunensis ACS-027-V-Sch2     MLYLEDLFTTVITLKFYIIVLIGILYILIHHYRYHPVLAYLDILLNYIPVLTHEFGHILFNKISGGRAKDLVIVTRPYERQMTSQQGYAITQSTSKLGHGITTLGGYILPPIMLLVGAASAHSEHPIIFLICYIAIFIYFLILTSRKWSPIIILILLVTLLYLFLQQAQYTFTHTIMSYSYHFILGVLLGEVIQSSWTIVKLTFQRPKTQWDGQALADMTHVPSIAFSLIWISINGYSLYLLFQYSFY
fig|396513.4.peg.277   Staphylococcus carnosus subsp. carnosus TM300     MQLFKEIISTPMTLHLYLVVIIAIIYMTVHHYRNRPGLAVTDIILNYIPVLTHEFGHIVFNKISGGRTEDLVIVTSPRERIATSQQGFAITRASRRSTMIITTLGGYVMPPLMLALGIFSAYFHYPSLFVLSYLLIFIYFVCITSRKGIPILIAILLGLMIYLLIQNNQPEMIVLILSIVYHFILGVLFGELLQSIWTMLRLTFTQYPIEWDGTALRNLTHLPVVVFTTLWVAFNFYVVYAIVKYLLF
fig|273036.3.peg.617   Staphylococcus aureus RF122     MNYLSNFFNTTIQLNIYIIVIVATCYITIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|426430.6.peg.595   Staphylococcus aureus subsp. aureus str. Newman     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGII                                                            
fig|904744.3.peg.2536   Staphylococcus aureus subsp. aureus 21259     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPILNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|1158485.3.peg.2521   Staphylococcus aureus M1311     MNYLSNFFNTTIQLNIYVIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|1213730.3.peg.2500   Staphylococcus aureus M0877     MNYLSNFFNTTIQLNIYVIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|585155.3.peg.1192   Staphylococcus aureus subsp. aureus H19     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMAPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVISLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|1157002.3.peg.353   Staphylococcus aureus HI111     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|553567.3.peg.2340   Staphylococcus aureus A5948     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQEFAITQSRHLAGQWLTTIGGYFMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|681288.4.peg.591   Staphylococcus aureus subsp. aureus ED98     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILSVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|1169274.3.peg.556   Staphylococcus aureus M1309     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL
fig|158879.11.peg.622   Staphylococcus aureus subsp. aureus N315     MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVNILLKYTHL