(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00004583

fig|551115.6.peg.1416   Trichormus azollae 0708      NFFQGTKEELEKVVWPS−−−−−−−−−−−RKQLVSESAAV−−−−LLMVTLSASLIYLVDGLFA
fig|533240.4.peg.722   Cylindrospermopsis raciborskii CS-505      NFFQGTKEELEKVVWPS−−−−−−−−−−−RKQLVSESAAV−−−−LLMVTLSASLIYLVDGLFA
fig|103690.1.peg.5605   Nostoc sp. PCC 7120      NFFQGTKEELEKVVWPS−−−−−−−−−−−RKQLISESAAV−−−−LLMVTLSASLIYLVDGLFA
fig|63737.11.peg.6833   Nostoc punctiforme PCC 73102      NFIQGTKEELDKVVWPS−−−−−−−−−−−RKQIVSESAAV−−−−LLMVALSASLIYLVDGLFG
fig|533247.5.peg.735   Raphidiopsis brookii D9      NFFQGTKEELDKVVWPS−−−−−−−−−−−RKQLVSESAAV−−−−LLMVTLSASLIYLVDGLFS
fig|197221.1.peg.293   Thermosynechococcus elongatus BP-1      EFFRETKEELNKVVWPD−−−−−−−−−−−RQRLIGESAAV−−−−ILIVSLSAAVIYLVDELFR
fig|395961.9.peg.3990   Cyanothece sp. PCC 7425      QFFQETKEELDKVVWPD−−−−−−−−−−−RQRLIGESVAV−−−−VLMVALSATTIYLVDQLFS
fig|203124.6.peg.342   Trichodesmium erythraeum IMS101     VTFFQETKEELDKVVWPS−−−−−−−−−−−REQLISESVAV−−−−LLMVILSATIIYLVDEFFS
fig|376219.5.peg.2360   Arthrospira sp. PCC 8005      GFLKETKEELDKVVWPT−−−−−−−−−−−RQQLLSESAGV−−−−LLMVMLSATLIYLIDNFFR
fig|313612.3.peg.897   Lyngbya sp. PCC 8106     VDFFKETKEELDKVVWPS−−−−−−−−−−−RQQLFSESAGV−−−−LLMIMLSATLIYLVDNIFR
fig|118168.3.peg.3204   Microcoleus chthonoplastes PCC 7420     VTFLQETKEELSKVVWPS−−−−−−−−−−−RQQLISESAAV−−−−LLMVVLSATLIYLVDGLF 
fig|91464.3.peg.466   Synechococcus sp. PCC 7335       FAQGTREELTKVIWPT−−−−−−−−−−−RQQLISESAAV−−−−ILMVGLSATLIYFVDKLFG
fig|269084.6.peg.1038   Synechococcus elongatus PCC 6301     VSFLQETRAELSKVVWPS−−−−−−−−−−−RQQLISESAAV−−−−LLMVSLSATLIYLINELFS
fig|1148.72.peg.2373   Bacillus subtilis BEST7613      NFIAATKDELAKVVWPS−−−−−−−−−−−RQQLISESVAV−−−−ILMVILVSTVIYFVDQIFG
fig|391612.5.peg.4098   Cyanothece sp. CCY0110      NFVVETKEELAKVVWPS−−−−−−−−−−−RQQLLSESAAV−−−−ILMVSLVATVIYLVDNLFS
fig|713887.3.peg.231   cyanobacterium UCYN-A     KNFVIDTREELAKIVWPS−−−−−−−−−−−RQQLLSESAAV−−−−ILMVSLVATVIYLVDNFFT
fig|41431.3.peg.1885   Cyanothece sp PCC 8801      NFINETKEELGKVVWPS−−−−−−−−−−−RQQLLSESVAV−−−−ILMVSLVATVIYLVDNLFA
fig|32049.15.peg.1248   Synechococcus sp. PCC 7002      KYANETKEELAKVVWPS−−−−−−−−−−−RQQLISESAAV−−−−ILMVILVATVIYVVDNLF 
fig|1160286.3.peg.2929   Microcystis aeruginosa PCC 9717     KEFVNESKEELAKVVWPS−−−−−−−−−−−RQQLLSESAAV−−−−MLMVTLVATLIYLIDKFFA
fig|65393.5.peg.1063   Cyanothece sp PCC 7424      EFANETKEELEKVVWPS−−−−−−−−−−−RQQLISESAAV−−−−ILMVTLVATVIYLVDNFFA
fig|497965.5.peg.1843   Cyanothece sp. PCC 7822      EFTKETKEELGKVVWPS−−−−−−−−−−−RQQLISESAAV−−−−ILMVTLVATIIYLVDNFFA
fig|321332.10.peg.1227   Synechococcus sp. JA-2-3B'a(2-13)      GFIQETRTELSKIVWPS−−−−−−−−−−−RRQLIGESVGV−−−−LLIVLAFASFIYLVDQVFA
fig|321327.20.peg.1761   Synechococcus sp. JA-3-3Ab      GFLQETRAELAKIVWPS−−−−−−−−−−−RQQLISESVGV−−−−LLIVLAFASFIYLVDQLFG
fig|316278.3.peg.2376   Synechococcus sp. RCC307        IESTLAELRRVVWPS−−−−−−−−−−−RQQLISESVAV−−−−LLMVTLSAAAIASLDRFFR
fig|180281.4.peg.751   Cyanobium sp. PCC 7001             AELRKVVWPS−−−−−−−−−−−RQQLFSESVAV−−−−ILMVGLSAAAIAAIDRFYG
fig|69042.12.peg.2766   Synechococcus sp. WH 5701      GFVSSTLEELRKVVWPS−−−−−−−−−−−RQQLFSESVAV−−−−ILMVSLSAATIAAVDRFYS
fig|59922.7.peg.2830   Prochlorococcus marinus str. MIT 9303      GFLAATYEELSLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAAFIAAVSRFYS
fig|74547.5.peg.2646   Prochlorococcus marinus str. MIT 9313      GFLAATYEELSLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAAFIAAVSRFYS
fig|110662.3.peg.1103   Synechococcus sp. CC9605      GFLADTVDELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAATIAAVSRLFG
fig|110662.5.peg.2639   Synechococcus sp. CC9605      GFLADTVDELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAATIAAVSRLFG
fig|166314.3.peg.636   Synechococcus sp. WH 8109      GFLADTVDELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAATIAAVSRFFG
fig|316279.3.peg.889   Synechococcus sp. CC9902      GFLADTVQELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAATIAAVSRFFG
fig|313625.3.peg.547   Synechococcus sp. BL107      GFLAETVQELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAATIAAVSRFFG
fig|84588.4.peg.2495   Synechococcus sp. WH 8102      GFLPATVDELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVSLSAAGIAAVSRFFG
fig|167539.1.peg.232   Prochlorococcus marinus subsp. marinus str. CCMP1375     KGFLPSTVDELKLVVWPS−−−−−−−−−−−RQQLFSESIAV−−−−ILMVTLSAASIAAVSRFYG
fig|93059.3.peg.1269   Prochlorococcus marinus str. MIT 9211     KGFLGSTIDELKLVVWPT−−−−−−−−−−−RQQLFSESIAV−−−−ILMVTLSAAAIAAVSRFYG
fig|167542.7.peg.238   Prochlorococcus marinus str. MIT 9515     KNFLTSTVDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVSFSAAAIASVSRFYG
fig|93060.3.peg.223   Prochlorococcus marinus str. MIT 9215      NFFRSTYDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVTFSAAAIASVSRFYG
fig|93058.3.peg.1090   Prochlorococcus marinus str. MIT 9202      NFFRSTYDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVTFSAAAIASVSRFYG
fig|74546.3.peg.433   Prochlorococcus marinus str. MIT 9312     KNFFRSTYDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVSFSAAAIASVSRFYG
fig|167546.4.peg.222   Prochlorococcus marinus str. MIT 9301      NFFRSTYDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVSFSAAAIASVSRFYG
fig|146891.8.peg.225   Prochlorococcus marinus str. AS9601      NFFRSTYDELKLVVWPN−−−−−−−−−−−KQQLFSESVAV−−−−IIMVSFSAAAIASVSRFYG
fig|663278.3.peg.1584   Ethanoligenens harbinense YUAN-3     KRFLSETRAEFKKIIWPT−−−−−−−−−−−RRQVTSNTIVV−−−−LVTIAVIGAVVMALD    
fig|411485.10.peg.169   Faecalibacterium prausnitzii M21/2      KFFRDTKSELKKVVWPS−−−−−−−−−−−KQDVKTNTIVV−−−−LVTVAIAAVVMILLDAIFG
fig|411483.3.peg.618   Faecalibacterium prausnitzii A2-165      KFFRDTKSELKKVVWPS−−−−−−−−−−−KADVKTNTIVV−−−−LVTVAIAAVVMIALDAIFG
fig|411471.5.peg.4005   Subdoligranulum variabile DSM 15176      KYFKDTKSELKKVVWPS−−−−−−−−−−−KKDVKTNTITV−−−−IAVVLIAAIVLIVLDLIFG
fig|411471.5.peg.421   Subdoligranulum variabile DSM 15176      KYFKDTKSELKKVVWPS−−−−−−−−−−−KKDVKTNTITV−−−−IAVVLIAAIVLIVLDLIFG
fig|546269.3.peg.523   Filifactor alocis ATCC 35896      EYFGEVKTELKKVHWPS−−−−−−−−−−−KQELSEHTFTV−−−−IIMVLVTALFIFCIDAGVG
fig|448385.16.peg.447   Sorangium cellulosum 'So ce 56'          DVAAELAKVKWPT−−−−−−−−−−−KKEVTNATFVV−−−−IATTTVATLYLALLDRF  
fig|448385.11.peg.372   Sorangium cellulosum So ce 56          DVAAELAKVKWPT−−−−−−−−−−−KKEVTNATFVV−−−−IATTTVATLYLALLDRF  
fig|293826.4.peg.4314   Alkaliphilus metalliredigens QYMF      KFLRGVRSELKKVNWPN−−−−−−−−−−−RAEIKNHTGVV−−−−IIATLMAVVLLWILDSVFG
fig|350688.3.peg.470   Alkaliphilus oremlandi oremlandii OhILAs      KFIKGVRSELKKVNWPN−−−−−−−−−−−KKELTNNSVVV−−−−VITVTLATVAIWAIDSILG
fig|240015.3.peg.2796   Acidobacterium capsulatum ATCC 51196     MEFFKDVRSEMRKVVTPS−−−−−−−−−−−RAEVQSTTLVV−−−−IFSVFLFSAFFYVVDSIVG
fig|204669.11.peg.5002   Koribacter versatilis Ellin345     KSFYNDVRTEMKKVSTPS−−−−−−−−−−−RKEVQSTTVVV−−−−IITVFIFGLYFWLVDNAIG
fig|204669.6.peg.4660   Acidobacteria bacterium Ellin345     KSFYNDVRTEMKKVSTPS−−−−−−−−−−−RKEVQSTTVVV−−−−IITVFIFGLYFWLVDNAIG
fig|411467.6.peg.3068   Bacteroides capillosus ATCC 29799      KWFKEMKSELKKVQWPG−−−−−−−−−−−WKQVAKNTGIV−−−−IACVIVVGIFIWVFD    
fig|655811.4.peg.1716   Anaerococcus vaginalis ATCC 51170      GFFKSVSREFKKITWPT−−−−−−−−−−−KNETLNYSLLV−−−−IIVSVITGLLIWLLDIVFG
fig|1033733.3.peg.498   Anaerococcus sp. JC48      GFFKSIRREFKKITWPT−−−−−−−−−−−KNETLNYSLLV−−−−IIVSVITGLLIWLLDIVFG
fig|553184.4.peg.478   Atopobium rimae ATCC 49626     KNYFSGVRTEMHRVVWPT−−−−−−−−−−−KPELANWSLAV−−−−ICMVVFFGLMTFLVDTGI 
fig|521095.5.peg.342   Atopobium parvulum DSM 20469       YFAGVRTEMHRVVWPS−−−−−−−−−−−SSELAGFSVAV−−−−IATIVFFGLVTWLVDTGI 
fig|525256.4.peg.711   Atopobium vaginae DSM 15829     KTYFKAVKTEMHRVVWPS−−−−−−−−−−−KPELKNYSGAV−−−−ICALVVCGLAIWLVDTGF 
fig|521003.7.peg.278   Collinsella intestinalis DSM 13280     KAYLASVRSEMKRVVWPT−−−−−−−−−−−KNELVNYTVAV−−−−CASLFVVGVAIALLDLVIG
fig|411903.6.peg.925   Collinsella aerofaciens ATCC 25986     KKYFASVKSEMKRVTWPD−−−−−−−−−−−KKELVNYSVVV−−−−CASLIVVGVVIALLDAGFG
fig|243164.10.peg.944   Dehalococcoides ethenogenes 195      GFFSNLVAELKKVVWPS−−−−−−−−−−−RPDVIKLTTMV−−−−LVVAIAVGILLGVVDYGFS
fig|246199.4.peg.431   Ruminococcus albus 8      KYFKELRAELKKVVWPT−−−−−−−−−−−RQQVVNNTGVV−−−−LVVMSLMGLFLFAVDTGLS
fig|537013.3.peg.1021   Clostridium methylpentosum DSM 5476      NYFKDLRSETKKVVWPT−−−−−−−−−−−KSQIINNTIIV−−−−LVTIIVLGIFIALLDFGLG
fig|1138384.3.peg.1699   Clostridium thermocellum AD2      KYFKDVKNELKRVIWPT−−−−−−−−−−−RSQLINNTITV−−−−LILCFIVGVLIWLFDLGFG
fig|394503.6.peg.317   Clostridium cellulolyticum H10     VRLYKEIRAELKKVIWPN−−−−−−−−−−−RTQLINNTVTV−−−−LIFCLIVGTIIWVADFGFT
fig|588581.3.peg.600   Clostridium papyrosolvens DSM 2782     VKLYREIKAELKKVIWPN−−−−−−−−−−−RTQLINNTATV−−−−LIFCLIVGAIIWVADFGFT
fig|416591.4.peg.496   Thermotoga lettingae TMO     KKFFREVAAEAKKTHWPS−−−−−−−−−−−RNELLTSTSVV−−−−VLILVVMGVYFFVLDMVFS
fig|416591.5.peg.499   Thermotoga lettingae TMO     KKFFREVAAEAKKTHWPS−−−−−−−−−−−RNELLTSTSVV−−−−VLILVVMGVYFFVLDMVFS
fig|309803.4.peg.212   Thermotoga neapolitana DSM 4359      RFFREVIAEAKKISWPS−−−−−−−−−−−RKELLTSFSVV−−−−LVILIVTGLYFFVLDFIFS
fig|443254.3.peg.1596   Marinitoga piezophila KA3      KFFREVIAEAKKISWPS−−−−−−−−−−−RKELLTSFGVV−−−−LVILAVTSVYFFVLDFIFS
fig|391009.4.peg.672   Thermosipho melanesiensis BI429      KFFREVKTEIKKTHWPN−−−−−−−−−−−KKELWGATGVV−−−−LFILLVTGVYFFVLDLVFS
fig|484019.3.peg.648   Thermosipho africanus TCF52B     KKFFREVKTEIKKTHWPN−−−−−−−−−−−RKELWGATGVV−−−−LVILLVTGVYFFALDLIFS
fig|381764.8.peg.889   Fervidobacterium nodosum Rt17-B1     KKFFAEVKSEAKKTTWPN−−−−−−−−−−−REELLASTGVV−−−−LFILAVSAVYLFLVDLLFS
fig|521045.3.peg.1935   Kosmotoga olearia TBF 19.5.1      RFITEVRQETKKVTWPN−−−−−−−−−−−RKQLLSTTGAV−−−−MVVLLVCGIFLGLLDIIFT
fig|511680.4.peg.421   Butyrivibrio crossotus DSM 2876     VGFFASMKAEFKKIIWPN−−−−−−−−−−−RQSLGRQTLAV−−−−LVCTVVLGLIIFGLDFVIS
fig|566461.4.peg.2028   Streptomyces ghanaensis ATCC 14672       FYRQIVAELRKVVWPT−−−−−−−−−−−RNQLTSYTTAV−−−−IIFVVIMIGLVTLFDYGLG
fig|467200.3.peg.2575   Streptomyces griseoflavus Tu4000       FYRQIIAELRKVVWPT−−−−−−−−−−−RNQLTSYTTAV−−−−IVFVVLMIGLITLIDYGLS
fig|645465.3.peg.2442   Streptomyces sp. e14       FYRQIVAELRKVVWPT−−−−−−−−−−−RGQLSSYTTVV−−−−IFFVAIMIALVTVIDYGL 
fig|463191.3.peg.1547   Streptomyces sviceus ATCC 29083       FYRQIVAELRKVVWPS−−−−−−−−−−−RNQLTTYTTVV−−−−IVFVLVMIGLVTVIDYGL 
fig|591159.3.peg.2836   Streptomyces viridochromogenes DSM 40736       FYRQIIAELRKVVWPT−−−−−−−−−−−RNQLTTYTTVV−−−−IIFVVIMIGLVTVIDYGLS
fig|443255.19.peg.3388   Streptomyces clavuligerus ATCC 27064       FYRQIIAELRKVVWPT−−−−−−−−−−−RNQLTTYTTVV−−−−IIFVVIMIGLVTVIDYGFQ
fig|457428.4.peg.916   Streptomyces lividans TK24       FYRQIVAELRKVVWPS−−−−−−−−−−−RNQLTTYTTVV−−−−IIFVVIMIGLVTLIDYGFS
fig|100226.15.peg.4717   Streptomyces coelicolor A3(2)       FYRQIVAELRKVVWPS−−−−−−−−−−−RNQLTTYTTVV−−−−IIFVVIMIGLVTLIDYGFS
fig|683219.3.peg.393   Streptomyces sp. SA3_actG       FYRQVIAELRKVVWPT−−−−−−−−−−−RNQLSTYTTVV−−−−IVFVVIMIGLVTVIDYGFS
fig|457427.3.peg.3234   Streptomyces hygroscopicus ATCC 53653       FYRQIIAELRKVVWPT−−−−−−−−−−−RSQLSTYTSVV−−−−IVFVLIMIGIVTVIDYGF 
fig|591167.6.peg.2612   Streptomyces flavogriseus ATCC 33331       FYRQIVAELRKVVWPT−−−−−−−−−−−RSQLSTYTAVV−−−−IVFVVVMIGLVTVIDFGFA
fig|1155717.3.peg.4949   Streptomyces sp. DvalAA-83       FYRQIVAELRKVVWPT−−−−−−−−−−−RSQLTTYTTVV−−−−IAFVVVMIGLVTVIDFGFA
fig|479433.4.peg.7413   Catenulispora acidiphila DSM 44928       FYRQIIAELRKVVWPT−−−−−−−−−−−RNELTTYTTVV−−−−IVFVAIMVGIVATLDYGFS
fig|351607.8.peg.320   Acidothermus cellulolyticus 11B        YRQIVAEMRKVIWPT−−−−−−−−−−−RRELVTYTIVT−−−−VVFAVVMIAIVAGLDYG  
fig|351607.5.peg.291   Acidothermus cellulolyticus 11B        YRQIVAEMRKVIWPT−−−−−−−−−−−RRELVTYTIVT−−−−VVFAVVMIAIVAGLDYG  
fig|656024.3.peg.834   Frankia symbiont of Datisca glomerata      RFYREVVAELRKVVYPG−−−−−−−−−−−RSELVTYVIVV−−−−LVFCSITVAFVASLDFGLT
fig|471852.4.peg.3054   Thermomonospora curvata DSM 43183       FVRQIIAELRKVIWPT−−−−−−−−−−−RSELINYTLVS−−−−LVFVLVMMAFVAGLDWGLQ
fig|471852.6.peg.4453   Thermomonospora curvata DSM 43183       FVRQIIAELRKVIWPT−−−−−−−−−−−RSELINYTLVS−−−−LVFVLVMMAFVAGLDWGLQ
fig|269800.4.peg.2807   Thermobifida fusca YX     VTFTKQVVAELRKVRWPT−−−−−−−−−−−QRELFTYTVVV−−−−IVFVLIMIGYVSLVNFGFG
fig|1169153.3.peg.1762   Nocardiopsis sp. CNS639     VTFTKQVAGELRKVRWPT−−−−−−−−−−−RRELVTYTIVV−−−−LVFVLVVLGYVSLVDWGFG
fig|479432.4.peg.218   Streptosporangium roseum DSM 43021       FYRQVVAELRKVIWPT−−−−−−−−−−−RKDLISYTIIV−−−−LVFVLIMVGIVSGLDAVFT
fig|469371.4.peg.299   Thermobispora bispora DSM 43833       FYRQVVAELRKVIWPR−−−−−−−−−−−RNELITYTAVV−−−−LVFVLIMVGIVFGLDTLMG
fig|446470.5.peg.6112   Stackebrandtia nassauensis DSM 44728       FIREIFEQLRKVVYPT−−−−−−−−−−−RKQLLTYTAVV−−−−LVFVTIMIGVIYGLDYVMS
fig|478801.5.peg.2028   Kytococcus sedentarius DSM 20547       FLQQVIDELRKIVRPT−−−−−−−−−−−RDELVSYTIVV−−−−IVFVVVLMAFVFGLDQLFS
fig|465515.4.peg.1671   Micrococcus luteus NCTC 2665       FLRQVVDELRKVVTPT−−−−−−−−−−−SEELLRTTGVV−−−−LAFVAFMILLVMGLDWVFG
fig|596312.3.peg.522   Micrococcus luteus SK58       FLRQVVDELRKVVTPT−−−−−−−−−−−SEELLRTTGVV−−−−LAFVAFMILLVMGLDWVFG
fig|452863.6.peg.63   Arthrobacter chlorophenolicus A6     FLFLRQVIGELRKVVTPT−−−−−−−−−−−RKELFRYTVTV−−−−VAFVAFMILFVTLVDLGFG
fig|762948.4.peg.346   Rothia dentocariosa ATCC 17931     FRFLREVISELKKVTTPT−−−−−−−−−−−RKELAIYFFGV−−−−LFFVVFMILFISGLDWVFG
fig|446465.4.peg.185   Brachybacterium faecium DSM 4810       FIRQVIAELRKVVVPT−−−−−−−−−−−RRELVLYSITV−−−−LLFVVFMILLIFGLDAAFS
fig|446471.6.peg.624   Xylanimonas cellulosilytica DSM 15894       FVRQVVGELKKVVSPT−−−−−−−−−−−RQELLTYTGVV−−−−LVFVAIVMAFVGLLDYLIG
fig|31964.6.peg.2675   Clavibacter michiganensis subsp. sepedonicus       FIKQVVQELKKVVTPT−−−−−−−−−−−RKELLTFTGVV−−−−LAFVIVMMVIVSLLDQLFG
fig|281090.11.peg.283   Leifsonia xyli subsp. xyli str. CTCB07       FIRQVIGELKKVVTPT−−−−−−−−−−−RKELVSYTGVV−−−−LVFVVIMMALVSLLDWIFG
fig|452863.6.peg.3392   Arthrobacter chlorophenolicus A6       FVRQIIGELKKVVAPT−−−−−−−−−−−RKELINYTLVV−−−−LVFVAIMMVIVSLLDIGFG
fig|1118963.3.peg.3213   Arthrobacter sp. Rue61a       FVRQVIGELKKVVAPT−−−−−−−−−−−RKELINYTLVV−−−−LVFVAIMMLIVSLLDIAFG
fig|290399.4.peg.3388   Arthrobacter sp. FB24       FIRQVIGELKKVVAPT−−−−−−−−−−−RKELINYTLVV−−−−LVFVIIMMLIVTVLDLAFG
fig|321955.4.peg.2064   Brevibacterium linens BL2      QFFREVIAELKKVVTPT−−−−−−−−−−−RKQLVNYTLVV−−−−LGFILFMM           
fig|288705.4.peg.1007   Renibacterium salmoninarum ATCC 33209       FVRQVIGELRKVVTPT−−−−−−−−−−−RKELINYTIVV−−−−LVFVIIMMAIIWVLDFAFG
fig|641146.3.peg.1270   Scardovia inopinata F0304      QFIKQVLDEMRKVVAPS−−−−−−−−−−−GLELLKWSLAV−−−−FIFVLLLMLFTTGIDFGLG
fig|864564.3.peg.1294   Parascardovia denticolens DSM 10105       FIKQVVDEMRKVVAPS−−−−−−−−−−−GFELFKWSVAV−−−−FIFVLLLMLFTFGIDYGLG
fig|703613.4.peg.329   Bifidobacterium animalis subsp. animalis ATCC 25527       FIKQIIDELRKVVTPT−−−−−−−−−−−RKQLFYWSLAV−−−−FIFVALLMVFVTAMDFGLG
fig|887326.3.peg.1252   Mobiluncus curtisii ATCC 51333     VQFFRQVVDEMKKVVYPT−−−−−−−−−−−SEELWRYFLVV−−−−IVFVAIIMTAVGLMDLGFG
fig|525246.3.peg.688   Actinomyces urogenitalis DSM 15434       FFRQVIDELRKVVWPT−−−−−−−−−−−RKELWTYFLVV−−−−VVFIVAIMAYTGILDFIF 
fig|313589.3.peg.2625   Janibacter sp. HTCC2649       FISQILDELRKVVRPT−−−−−−−−−−−RNELWNYTLVV−−−−IVFVTVMMALVSALDFGFG
fig|446469.6.peg.2945   Sanguibacter keddieii DSM 10542       FVRQVVAELKKVVTPT−−−−−−−−−−−RSELWNYTLVV−−−−IVFVLVCMAFVLALDYVI 
fig|446469.6.peg.5848   Sanguibacter keddieii DSM 10542       FVRQVVAELKKVVTPT−−−−−−−−−−−RSELWNYTLVV−−−−IVFVLVCMAFVLALDYVI 
fig|471853.4.peg.3584   Beutenbergia caverna cavernae DSM 12333       FVRQVIAELKKVVRPT−−−−−−−−−−−RSELMTYTAVV−−−−IVFVLAVMLYVGVLDFGIG
fig|405948.14.peg.1669   Saccharopolyspora erythraea NRRL 2338 (Prj:17885)      RFLREVVAELRKVIWPT−−−−−−−−−−−RKALVTYTLVV−−−−LVFVSVMVAFIAGVDILFA
fig|644283.4.peg.5587   Micromonospora aurantiaca ATCC 27029      RFFREVVAELRKVIWPT−−−−−−−−−−−RKELLTYTAVV−−−−VTFVAVMLAIVAGLDYGFA
fig|219305.4.peg.1256   Micromonospora sp. ATCC 39149      RFFREVVAELRKVIWPT−−−−−−−−−−−RKELLTYTAVV−−−−VTFVAVMLTIVAGLDFAFA
fig|1169195.3.peg.1205   Salinispora tropica CNS416             AELRKVIWPT−−−−−−−−−−−RKELLTYASVV−−−−IVFVAVMLAIVAGLDLAFA
fig|1169178.3.peg.3182   Salinispora arenicola CNS051     VRFVREVVAELRKVIWPT−−−−−−−−−−−RKELLTYTAVV−−−−IVFVAVMLAIVAGLDLAFA
fig|446462.8.peg.6880   Actinosynnema mirum DSM 43827     FRYIREVVGELRKVIWPT−−−−−−−−−−−RKQMVTYTSVV−−−−LVFVAFMTALVFGLDIAFA
fig|446462.6.peg.6857   Actinosynnema mirum DSM 43827     FRYIREVVGELRKVIWPT−−−−−−−−−−−RKQMVTYTSVV−−−−LVFVAFMTALVFGLDIAFA
fig|591158.3.peg.3562   Streptomyces sp. AA4      RFIREVWAELRKVIWPN−−−−−−−−−−−RKQMVTYTAVV−−−−LVFVVFMVALVSGLDLGF 
fig|471857.4.peg.3244   Saccharomonospora viridis DSM 43017      RFIREVWGELRKVIWPT−−−−−−−−−−−RKQMVTYTTVV−−−−LLFLVFMVALVAGLDFVF 
fig|479431.6.peg.1028   Nakamurella multipartita DSM 44233      RFLREVVAELRKVIWPS−−−−−−−−−−−RNQMVTYTIVV−−−−IAFVTFMVALVGVLDLLFA
fig|526225.5.peg.3159   Geodermatophilus obscurus DSM 43160      RFLREVVAELRKVIWPG−−−−−−−−−−−RRELITYTTVV−−−−IVFVAFIVALVAGLDLLFA
fig|596309.3.peg.2247   Rhodococcus erythropolis SK121      KFFREVIAELRKVIWPN−−−−−−−−−−−RKQMITYTSVV−−−−LTFVVFMVAFISGVDIA  
fig|234621.6.peg.2201   Rhodococcus erythropolis PR4      KFFREVIAELRKVIWPN−−−−−−−−−−−RKQMITYTSVV−−−−LTFVVFMVAFISGVDIA  
fig|632772.3.peg.1665   Rhodococcus opacus B4      RFLREVIAELRKVIWPN−−−−−−−−−−−RKQMITYTSVV−−−−LAFVVFMVTFIGVLDLA  
fig|247156.8.peg.5125   Nocardia farcinica IFM 10152     IKFLREVIAELRKVIWPN−−−−−−−−−−−RKQMVTYTSVV−−−−LVFVVFMVAFISGLDLAF 
fig|350058.8.peg.1270   Mycobacterium vanbaalenii PYR-1     INYLKEVVGELRKVIWPN−−−−−−−−−−−RKEMATYTTVV−−−−LLFLVFMVALIGGVDLGLG
fig|350054.11.peg.5222   Mycobacterium gilvum PYR-GCK     INYLKEVLGELRKVIWPN−−−−−−−−−−−RKEMIAYTTTV−−−−LFFLIFMVAMIGGVDLGLA
fig|164757.7.peg.945   Mycobacterium sp. JLS     VNYIKQVVAELRKVIWPN−−−−−−−−−−−RKQMVSYTSVV−−−−LVFLAFMVALIAGFDYGMA
fig|164756.15.peg.944   Mycobacterium sp. MCS     VNYIKQVVAELRKVIWPN−−−−−−−−−−−RKQMVSYTSVV−−−−LVFLAFMVALIAGFDYGMA
fig|246196.19.peg.1328   Mycobacterium smegmatis str. MC2 155     VNYLKQVVAELRKVIWPN−−−−−−−−−−−RKQMVSYTTVV−−−−LVFLVFMVALIAGADYGLA
fig|246196.1.peg.1337   Mycobacterium smegmatis str. MC2 155     VNYLKQVVAELRKVIWPN−−−−−−−−−−−RKQMVSYTTVV−−−−LVFLVFMVALIAGADYGLA
fig|557599.3.peg.2987   Mycobacterium kansasii ATCC 12478      NYIKQVVAEMRKVIWPN−−−−−−−−−−−RRQMITYTSVV−−−−LVFLAFMVALVGGADLGLG
fig|362242.7.peg.917   Mycobacterium ulcerans Agy99      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LVFLAFMVALVGSADLGLS
fig|216594.1.peg.3895   Mycobacterium marinum M      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LVFLAFMVALVGSADLGLS
fig|1078011.3.peg.1688   Mycobacterium avium subsp. avium DT 78      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVGLADFGLT
fig|243243.7.peg.4443   Mycobacterium avium 104      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVGLADFGLT
fig|525368.3.peg.1307   Mycobacterium parascrofulaceum ATCC BAA-614      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVGLADFGLT
fig|561304.4.peg.3634   Mycobacterium leprae Br4923      NYLKQVVGEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVGLADFGLA
fig|272631.1.peg.1156   Mycobacterium leprae TN      NYLKQVVGEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVGLADFGLA
fig|611304.3.peg.3482   Mycobacterium tuberculosis K85      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLPFMVALVAGADLGLT
fig|1091501.3.peg.830   Mycobacterium tuberculosis RGTB423      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQTLTYTSVV−−−−LAFLAFMVALVAGADLGLT
fig|555461.3.peg.837   Mycobacterium tuberculosis '98-R604 INH-RIF-EM'      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVAGADLGLT
fig|83331.1.peg.669   Mycobacterium tuberculosis CDC1551      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVAGADLGLT
fig|1806.1.peg.630   Mycobacterium microti OV254      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVAGADLGLT
fig|1765.178.peg.184   Mycobacterium bovis str. 10-2603      NYLKQVVAEMRKVIWPN−−−−−−−−−−−RKQMLTYTSVV−−−−LAFLAFMVALVAGADLGLT
fig|521096.4.peg.822   Tsukamurella paurometabola DSM 20162       FLRQVVAELRKVIWPT−−−−−−−−−−−RSQMINYTIIV−−−−LVFVVVLTAFVSLLDLGFA
fig|306537.10.peg.1888   Corynebacterium jeikeium K411     VDYIRGVISEMGKVIWPT−−−−−−−−−−−GREMVNYTVIV−−−−LLFLIFVCALVAGTDWAAS
fig|504474.4.peg.269   Corynebacterium urealyticum DSM 7109       YLRGVISEMRKVIWPT−−−−−−−−−−−GREMVTYSLVV−−−−LVFLILMTALVAGVDYV  
fig|645127.4.peg.1939   Corynebacterium kroppenstedtii DSM 44385     VDYFRGVIAEMRKVIWPT−−−−−−−−−−−WRQMGVYTGVV−−−−LLFLIVVIGIVSGVDFL  
fig|553204.6.peg.606   Corynebacterium amycolatum SK46       FIKQVVDELRKVIWPT−−−−−−−−−−−GRQMVTYSIIV−−−−ILFLIAMIALVWGVDTL  
fig|548478.3.peg.1387   Corynebacterium glucuronolyticum ATCC 51866     KSYIPEVIEQMKKVIWPT−−−−−−−−−−−GKQMLNYTLIV−−−−FLFLIVMTIVVWGTDIL  
fig|525260.4.peg.239   Corynebacterium accolens ATCC 49725       FPGEVVSEMKKVVWPT−−−−−−−−−−−RGEMLQYTLIT−−−−FAFLIVMTALVWGVDTL  
fig|548476.7.peg.1548   Corynebacterium aurimucosum ATCC 700975 (Prj:31451)      SFPGEVVSEMKKVVWPT−−−−−−−−−−−GKEMLQYVLVT−−−−FAFLVVLTALVWGVDTL  
fig|553206.4.peg.1002   Corynebacterium tuberculostearicum SK141       FPGEVVSEMKKVVWPT−−−−−−−−−−−AKEMLQYTLIT−−−−FAFLIVLTILVWGVDTL  
fig|525268.3.peg.454   Corynebacterium striatum ATCC 6940       FPGEVASEMKKVVWPT−−−−−−−−−−−TKEMVQYTLIT−−−−FAFLIVLTALVWGVDTL  
fig|649754.3.peg.1584   Corynebacterium ammoniagenes DSM 20306     VTFVPEVVSEIKKVVWPT−−−−−−−−−−−AKEMVQYTLVV−−−−FAFLIILTALVWGVDTL  
fig|585529.3.peg.170   Corynebacterium genitalium ATCC 33030       FPGEVVGEMRKVVWPT−−−−−−−−−−−GSQMVNYTLIV−−−−FGFLIVLTALVWGVDQG  
fig|196627.14.peg.474   Corynebacterium glutamicum ATCC 13032     ISFLPEVVGEVRKVIWPT−−−−−−−−−−−ARQMVTYTLVV−−−−LGFLIVLTALVSGVDFL  
fig|340322.5.peg.606   Corynebacterium glutamicum R     VSFLPEVVGEVRKVIWPT−−−−−−−−−−−ARQMVTYTLVV−−−−LGFLIVLTALVSGVDFL  
fig|196164.10.peg.2573   Corynebacterium efficiens YS-314 (Prj:34585)     VSFLPEVVTEIRKVIWPT−−−−−−−−−−−ARQMVTYTIVV−−−−LVFLIILTALVSGVDFI  
fig|257309.1.peg.402   Corynebacterium diphtheriae NCTC 13129     VSFVPEVASEMKKVIWPT−−−−−−−−−−−AQQMMSYTLIV−−−−FAFLILVTALVAGVDFL  
fig|698971.3.peg.339   Corynebacterium diphtheriae VA01     VSFVPEVASEMKKVIWPT−−−−−−−−−−−AQQMMSYTLIV−−−−FAFLILVTALVAGVDFL  
fig|553207.3.peg.529   Corynebacterium matruchotii ATCC 14266     VAFMPEVVSEMRKVIWPT−−−−−−−−−−−ARQMLNYTIIV−−−−FAFLILLTGLVAGVDFL  
fig|566549.5.peg.397   Corynebacterium matruchotii ATCC 33806     VAFMPEVVSEMRKVIWPT−−−−−−−−−−−ARQMLNYTIIV−−−−FAFLILLTGLVAGVDFL  
fig|526226.8.peg.1145   Gordonia bronchialis DSM 43247       FLTQVVAELKKVIWPT−−−−−−−−−−−RREMITYTIVV−−−−LVFVIVMTAFISGIDLAFA
fig|445971.6.peg.760   Anaerofustis stercorihominis DSM 17244      NFFRGVSVELKKVTWPT−−−−−−−−−−−KDELIQYTIVV−−−−VVICAVLTLFIWGLDTVLG
fig|525259.3.peg.3404   Clostridium difficile NAP08     FGYLKETKQELKRVTWPT−−−−−−−−−−−KKELFKNTGIV−−−−LTVVISCTILVWGIDTILS
fig|645462.3.peg.67   Clostridium difficile CD196     FGYLKETKQELKRVTWPT−−−−−−−−−−−KKELFKNTSIV−−−−LTVVISCTILVWGIDTILS
fig|445973.7.peg.79   Clostridium bartlettii DSM 16795     VAYIKETIAELKRVTWST−−−−−−−−−−−KKELLKNTGIV−−−−LATIISFTILAWALDTLLS
fig|500633.7.peg.1472   Clostridium hiranonis DSM 13275     FGYFRETKAELKRVTWPT−−−−−−−−−−−RKELFRNTGVV−−−−LAVVIFSTLAIWGIDTVLS
fig|649764.3.peg.472   Slackia exigua ATCC 700122     FKFLKDVRLELKRVTWPT−−−−−−−−−−−RQEVIRWTGVV−−−−LGALVFFGVFVAVLDAVIQ
fig|471855.4.peg.2623   Slackia heliotrinireducens DSM 20476     FKFLKDVSAEMKRVTWPS−−−−−−−−−−−RPEVIRWSGVV−−−−VGALLFFGVFVAVLDNLI 
fig|471855.5.peg.867   Slackia heliotrinireducens DSM 20476     FKFLKDVSAEMKRVTWPS−−−−−−−−−−−RPEVIRWSGVV−−−−VGALLFFGVFVAVLDNLI 
fig|655812.3.peg.936   Aerococcus viridans ATCC 11563     MQFLKDVWHEMRLTTWPS−−−−−−−−−−−GGELVRYTGIV−−−−LSTIIMVAIFLGIIDTL  
fig|638302.3.peg.1545   Selenomonas flueggei ATCC 43531     MKFLREVVAEMKKVSWST−−−−−−−−−−−RRELATYTGVV−−−−GIAIIVVCALIWICDTIFA
fig|457570.14.peg.196   Natranaerobius thermophilus JW/NM-WN-LF      KFLRETKIELKKVNWPN−−−−−−−−−−−RQQLITYTGVV−−−−LMTVAIVGVYFWILDTAF 
fig|401526.3.peg.1485   Thermosinus carboxydivorans Nor1     KRFLRDVRAELKKVSWPN−−−−−−−−−−−KQELVSYTGVV−−−−FVSVLVVALLIWVIDTGFS
fig|429009.3.peg.1929   Ammonifex degensii KC4      EFLLSVWQELKKVHWPT−−−−−−−−−−−RREVLIYTGVV−−−−LAAVGLVTLIIWLADSIFS
fig|498761.4.peg.1219   Heliobacterium modesticaldum Ice1      NFARGVASEMKKVHWPT−−−−−−−−−−−RQEVITYTGVV−−−−LTAVVFVAALIFVVDEALS
fig|264732.11.peg.2692   Moorella thermoacetica ATCC 39073      KFLKGSWAELKKVHWPT−−−−−−−−−−−RRELVTYTTVV−−−−LVSVLIVAALLSVFDSAFS
fig|635013.3.peg.299   Thermincola sp. JR     KKFLRGAWTELKKVNWLG−−−−−−−−−−−RKELVAFTGVV−−−−LVSVFIVGSAIFVVDTLLS
fig|246194.3.peg.2468   Carboxydothermus hydrogenoformans Z-2901      QYFRSVWAEVKKVHWPT−−−−−−−−−−−RNESIVYTGVV−−−−FLTVIIVGLIIWLFD    
fig|1090321.3.peg.2763   Desulfitobacterium hafniense PCP-1      EYFKGVWSELKKVHWPD−−−−−−−−−−−RKQLLTYTGVV−−−−LTAVAIVAVMLWVVDSGLS
fig|335541.7.peg.2553   Syntrophomonas wolfei subsp. wolfei str. Goettingen     KQFFLNVYSELKKVHWPN−−−−−−−−−−−RQQMIAYTGVV−−−−LIAVTLVAVIIWLFDSGLS
fig|643648.3.peg.2313   Syntrophothermus lipocalidus DSM 12680       YLRGVYNELKKVHWPN−−−−−−−−−−−RNQLVAYTAVV−−−−LISVALVAVIIWAFDF   
fig|580327.4.peg.416   Thermoanaerobacterium thermosaccharolyticum DSM 571      KFFREIKAEMKKVTWPT−−−−−−−−−−−RNDLLAYTEVV−−−−LVVVIAFTLLIFLADSAFS
fig|273068.5.peg.2297   Thermoanaerobacter tengcongensis MB4     VKFFREVKAEMKKVTWPG−−−−−−−−−−−RDTMITYTEVV−−−−LVVMVLFTIFIFLVDSVFS
fig|588857.3.peg.2303   Thermoanaerobacter sp. X561     VKFFKDIRAEMKKVTWPS−−−−−−−−−−−RKTVITYTEIV−−−−LIVMALLTVFIFLIDSIFS
fig|509193.4.peg.389   Thermoanaerobacter brockii subsp. finnii Ako-1     VKFFKDIRAEMKKVTWPS−−−−−−−−−−−RKTVITYTEIV−−−−LIVVALFTVFIFLIDSVFS
fig|583358.3.peg.2170   Thermoanaerobacter mathranii subsp. mathranii str. A3     VKFFKDVRAEMKKVTWPS−−−−−−−−−−−KESMITYTEIV−−−−LIVMAFFTVFIFLIDSVFS
fig|580331.4.peg.2039   Thermoanaerobacter italicus Ab9     VKFFKDVRAEMKKVTWPS−−−−−−−−−−−KESMITYTEIV−−−−LIAMVFFTVFIFLIDSVFS
fig|257314.1.peg.419   Lactobacillus johnsonii NCC 533     FKFIKSVNQTMAKVSWPT−−−−−−−−−−−WKQNRRDTGVV−−−−IISSILFGAYLGLLDLLFS
fig|324831.13.peg.348   Lactobacillus gasseri ATCC 33323     FKFFKSVNQTMAKVSWPT−−−−−−−−−−−WKQNRRDTGVV−−−−VISSILFGAYLGLLDLLFS
fig|879299.3.peg.310   Lactobacillus iners LactinV 09V1-c     FKFIKEVIASMKKVTWPT−−−−−−−−−−−LEQNRRDTSTV−−−−VWCSILFAAYLGVLDFIFQ
fig|575595.3.peg.1733   Lactobacillus crispatus 125-2-CHN     IKFFKSVGHEMKLVKWPS−−−−−−−−−−−AKQNRRDTATV−−−−ITSSILFAAYLGALDWLFT
fig|525365.3.peg.1811   Lactobacillus ultunensis DSM 16047     IKFFKSVVKEMKMVTWPS−−−−−−−−−−−AKQNRHDTMTV−−−−ITSSVLFAAYLGALDWLFS
fig|405566.6.peg.395   Lactobacillus helveticus DPC 4571     IKFFKSVAHEMKLVTWPT−−−−−−−−−−−AKQNRHDTMTV−−−−ITSSILFAAYLGALDWLFS
fig|272621.3.peg.468   Lactobacillus acidophilus NCFM     IKFFKGVAHEMKLVTWPT−−−−−−−−−−−AKQNRRDTVTV−−−−ITSSVLFAVYLGALDWLFS
fig|585524.3.peg.714   Lactobacillus amylolyticus DSM 11664     FKFFKSVGHEMKLVTWPT−−−−−−−−−−−YKQNRHDTMIV−−−−IVSSILFAIYLGALDWAFS
fig|321956.7.peg.1520   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365     IKFFKSVGQEMKLVHWPS−−−−−−−−−−−AKENRRDTANV−−−−VVTSLFYAIFLGSLDWAFA
fig|596326.3.peg.3034   Lactobacillus jensenii 208-1     FKFFKSVGQEMKKVTWPT−−−−−−−−−−−AKQNRRDTTTV−−−−IVTSVLFALFLGALDWAFS
fig|575607.3.peg.1013   Lactobacillus jensenii SJ-7A-US     FKFFKSVGHEMKKVTWPT−−−−−−−−−−−AKQNRRDTTTV−−−−IVTSVLFALFLGALDWAFS
fig|596326.3.peg.1910   Lactobacillus jensenii 208-1     FKFFKSVGHEMKKVTWPT−−−−−−−−−−−AKQNRRDTTTV−−−−IVTSVLFALFLGALDWAFS
fig|203120.7.peg.274   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293     INYFKNVAQEMKNVTWLT−−−−−−−−−−−GEQTSKETITV−−−−ITVSIIFALFLGGVDWLLQ
fig|1088720.3.peg.2214   Lactobacillus rhamnosus ATCC 8530     MKFIKSVFAEMKAVTWPT−−−−−−−−−−−AQQTRRDTFTV−−−−IMTSIIFAIYFAGVDWVI 
fig|321967.8.peg.2238   Lactobacillus casei ATCC 334     MKFIKSVFAEMKAVTWPT−−−−−−−−−−−ARQTRRDTFTV−−−−IMTSIIFAIYFAAVDWVI 
fig|1256211.3.peg.2477   Lactobacillus paracasei subsp. paracasei CNCM I-4649     MKFIKSVFAEMKAVTWPT−−−−−−−−−−−ARQTRRDTFTV−−−−IMTSIIFAIYFAAVDWVI 
fig|387344.13.peg.567   Lactobacillus brevis ATCC 367     IRFFKSVGAEMKQVSWPG−−−−−−−−−−−VKQTRHDTGTV−−−−VGISILFSIFFAVVDWIVQ
fig|575594.3.peg.1229   Lactobacillus coleohominis 101-4-CHN     FRFLKSVVQEMHKVVWPT−−−−−−−−−−−WKENRRDTGVV−−−−ISLTIFFVIFFALADWIIQ
fig|1169284.3.peg.2441   Enterococcus faecalis E99     MKFFRSVADEMKQVTWPT−−−−−−−−−−−KKQLRKDTLVV−−−−IETSILFAALFFIMDTVIQ
fig|1157487.3.peg.377   Enterococcus faecium HM1072     MKFLKSVKDEIKQVTWPS−−−−−−−−−−−RKQLRKDTLVV−−−−IETSIIFGLMFYVMDTAIQ
fig|525279.3.peg.1898   Enterococcus faecium TX1330     MKFLKSVKDEIKQVTWPN−−−−−−−−−−−RKQLRKDTLVV−−−−IETSILFGLMFYVMDTAIQ
fig|351627.4.peg.2124   Caldicellulosiruptor saccharolyticus DSM 8903     VKFFKDVRIEMKKVVWPS−−−−−−−−−−−QKQVIKHTIVV−−−−LTFTLFFTVFILLADVIY 
fig|632348.3.peg.1255   Caldicellulosiruptor kronotskyensis 2002      KFFRDVRIEMKKVVWPS−−−−−−−−−−−QKQVVKHTIVV−−−−LTFTLFFTVFILLADLIY 
fig|546273.3.peg.895   Veillonella dispar ATCC 17748      KFFRGVKAELKKVVWPT−−−−−−−−−−−KKELINYTIVV−−−−FLVTIFIAFIIYVLDAVFA
fig|1122949.3.peg.1334   Peptoniphilus lacrimalis DSM 7455      KYFRGVKSEFKKVVWPS−−−−−−−−−−−KKQIVQYSLIV−−−−IGVSIACALLLSLYDRFI 
fig|768727.3.peg.15   Veillonella parvula ACS-068-V-Sch12      KFFRGVKAELKKVVWPT−−−−−−−−−−−KKELINYTIVV−−−−FLVTIFIALIISVLDGLFA
fig|279808.3.peg.2419   Staphylococcus haemolyticus JCSC1435      SFFQGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFMVFFWVLDIGIG
fig|904339.3.peg.1073   Staphylococcus hominis VCU122      SFFQGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VATVIFFMVFFWVLDVGIG
fig|698737.3.peg.2298   Staphylococcus lugdunensis HKU09-01      NFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVLFFMAFFYVLDIGIG
fig|904334.3.peg.1672   Staphylococcus epidermidis VCU116      NFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDVGI 
fig|525378.3.peg.19   Staphylococcus epidermidis M23864:W1      NFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDIGI 
fig|979210.3.peg.1995   Staphylococcus epidermidis NIHLM037      SFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTIIV−−−−VSTVIFFLVFFYALDIGI 
fig|176280.1.peg.298   Staphylococcus epidermidis ATCC 12228      SFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTIIV−−−−VSTVIFFLVFFYALDIGI 
fig|1194526.3.peg.2129   Staphylococcus warneri SG1      SFFQGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDLGIT
fig|158879.11.peg.519   Staphylococcus aureus subsp. aureus N315      SFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDLGIT
fig|546342.4.peg.566   Staphylococcus aureus subsp. aureus str. JKD6008      SFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDLGIT
fig|93061.3.peg.502   Staphylococcus aureus subsp. aureus NCTC 8325      SFFKGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VSTVIFFLVFFYALDLGIT
fig|342451.4.peg.1976   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305      SFFQGVKSEMEKTSWPT−−−−−−−−−−−KEELFKYTVIV−−−−VATVVFFLVFFYALDLGIG
fig|396513.4.peg.189   Staphylococcus carnosus subsp. carnosus TM300      SFFKGVISEMEKTSWPT−−−−−−−−−−−KEEILKYTTIV−−−−IVTVVFFLIFFYALDLGIG
fig|592031.3.peg.94   Eubacterium saphenum ATCC 49989     KEYFKGVKLEMKKVVWPT−−−−−−−−−−−KKELGSYTTYV−−−−LVTCAFFTLLFYAADTGI 
fig|345219.8.peg.1300   Bacillus coagulans 36D1      NFFRNVASEMRKVSWPG−−−−−−−−−−−RKELVKYTITV−−−−LVTVAFLTLFFIVIDLGIS
fig|525367.9.peg.1026   Listeria grayi DSM 20601      NFFHNVISEMRKVSWPT−−−−−−−−−−−RKELVTYTVTV−−−−IITVILFAVFFMVIDFGI 
fig|546270.5.peg.1479   Gemella haemolysans ATCC 10379     IRFLKNVATEMRKVSWPT−−−−−−−−−−−FSELVRKTLIV−−−−IVVVGILMLFSYVVDLGIT
fig|634956.3.peg.3261   Geobacillus thermoglucosidasius C56-YS93     INFFKDVAREMKKVSWPS−−−−−−−−−−−RKELVNYTVIV−−−−LATVAFFTVFFAVVDLGIS
fig|471223.3.peg.117   Geobacillus sp. WCH70     MNFFKEVAREMKKVSWPS−−−−−−−−−−−RKELVNYTAIV−−−−LATVVFFTVFFAIVDLGIS
fig|691437.3.peg.97   Geobacillus sp. C56-T3     INFLKEVVRELKKVSWPN−−−−−−−−−−−RKELVNYTAVV−−−−LATVAFFTVFFAVVDLGIS
fig|235909.3.peg.1351   Geobacillus kaustophilus HTA426     INFLKEVVRELKKVSWPN−−−−−−−−−−−RKELVNYTAVV−−−−LATVAFFTVFFAVVDLGIS
fig|420246.5.peg.90   Geobacillus thermodenitrificans NG80-2      NFFKEVVRELKKVSWPN−−−−−−−−−−−RKELVNYTAVV−−−−LATVAFFTVFFAVIDLGIS
fig|1212546.3.peg.3006   Geobacillus caldoxylosilyticus G10      KFFREVVREMKKVSWPK−−−−−−−−−−−RKELVNYTITV−−−−LATVAFFTVFFAVVDLGIS
fig|272558.1.peg.117   Bacillus halodurans C-125      KFFGDVVAEMKRVSWPT−−−−−−−−−−−RKELTRYTLVV−−−−LGTVAFITVFFAVVDYGIS
fig|398511.4.peg.1648   Bacillus pseudofirmus OF4      KFFKDVVLEMKRVSWPT−−−−−−−−−−−RKELTRYTWVV−−−−LGTVAFITVFFAIVDYGIS
fig|649639.5.peg.106   Bacillus cellulosilyticus DSM 2522      KFLKDVSTEMKRVSWPK−−−−−−−−−−−RKELVRYTGVV−−−−IATVAFVAVYFAITDFGIS
fig|439292.5.peg.108   Bacillus selenitireducens MLS10     IKFLKDVSTEMKRVTWPN−−−−−−−−−−−RQELTKYTIVV−−−−STTVIIMAIFFAISDFAIS
fig|66692.6.peg.141   Bacillus clausii KSM-K16     VTFLRNVGREMKRVTWPT−−−−−−−−−−−KKELTRYTLVV−−−−LTTLIFMVAFFYLVDLGIS
fig|221109.4.peg.106   Oceanobacillus iheyensis HTE831     FKFLRNVSREMKKVSWPK−−−−−−−−−−−GKELRNYTVVV−−−−ISTVIFMAVFFFVVDLGIS
fig|441769.6.peg.195   Bacillus coahuilensis m4-4      KFFRNVSLEMKKTSWPK−−−−−−−−−−−RKELTRYTITV−−−−ISTVVFVALFFAAVDFGIS
fig|324057.4.peg.5644   Paenibacillus sp. JDR-2     FSFFADSWAELKKVRWPN−−−−−−−−−−−RKELTSYSIVV−−−−LLTIAFVTIYFWLLDIGIS
fig|1765.178.peg.5032   Mycobacterium bovis str. 10-2603            WAELKKVRWPN−−−−−−−−−−−RKELTNYTLIV−−−−LGTITVVAIYFWVLDIGIS
fig|481743.5.peg.5741   Geobacillus sp. Y412MC10     FSFFSESWAELKKVRWPN−−−−−−−−−−−RKELTNYTLIV−−−−LGTIVFVTIYFWVVDIGIS
fig|521098.5.peg.2709   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446     VAFFKESFRELKRVRWPK−−−−−−−−−−−RREVIVYTAAC−−−−LLVCAILGVLIWAFDIGVS
fig|360911.3.peg.1629   Exiguobacterium sp. AT1b     MNFLRDVWKELKKTSWPT−−−−−−−−−−−RKELTKYTITV−−−−IATVVVIGLFVFGVDTGVS
fig|262543.8.peg.92   Exiguobacterium sibiricum 255-15     MKFLRDVWNELKKTSWPK−−−−−−−−−−−RKELTKYTLTV−−−−IGMVIFMGVFIFGVDSGLS
fig|592026.3.peg.1757   Catonella morbi ATCC 51271     MGYIKNVGKEMKRVTWPS−−−−−−−−−−−LGEVNKYTWTV−−−−IIMVVLLGLYFGGIDFGLS
fig|592022.4.peg.92   Bacillus megaterium DSM319      NFLRDVGREMKKVSWPK−−−−−−−−−−−KNELTRYTITV−−−−ISTVVFMTLFFVVVDYGIS
fig|703612.3.peg.3658   Bacillus subtilis subsp. spizizenii ATCC 6633     MRFFKDVGKEMKKVSWPK−−−−−−−−−−−GKELTRYTITV−−−−ISTVIFFILFFALLDTGIS
fig|1126211.3.peg.106   Bacillus amyloliquefaciens Y2     MSFFKDVGKEMKKVSWPK−−−−−−−−−−−GKELTRYTITV−−−−ISTVIFFVIFFALLDTGIS
fig|1148.72.peg.103   Bacillus subtilis BEST7613     MKFFKDVGKEMKKVSWPK−−−−−−−−−−−GKELTRYTITV−−−−ISTVIFFVIFFALLDTGIS
fig|1230477.3.peg.1863   Bacillus subtilis S1-4     MKFFKDVGKEMKKVSWPK−−−−−−−−−−−GKELTRYTITV−−−−ISTVIFFVIFFALLDTGIS
fig|1169411.3.peg.4091   Bacillus licheniformis 10-1-A     IKFLKNVGKEMKKVTWPK−−−−−−−−−−−GKELTRYTITV−−−−ITTVIFFAIFFALIDSGIT
fig|315750.5.peg.85   Bacillus pumilus SAFR-032     ISFLKSVGKEMKKVSWPK−−−−−−−−−−−KNEMIRYTITV−−−−ILTVVFFAIFFSFLDIGIS
fig|1053226.3.peg.5941   Bacillus cereus VD048      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTTTV−−−−IATVVFFAIFFAVVDMGIS
fig|315749.8.peg.101   Bacillus cytotoxicus NVH 391-98      NFFGDVSREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−IATVIFFAIFFAVVDMGIS
fig|526967.3.peg.2206   Bacillus cereus 172560W      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−VATVVFFAIFFAVVDMGIS
fig|572264.4.peg.92   Bacillus cereus 03BB102      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−IATVVFFAIFFAVVDMGIS
fig|281309.8.peg.92   Bacillus thuringiensis serovar konkukian str. 97-27      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−IATVVFFAIFFAVVDMGIS
fig|486621.3.peg.3728   Bacillus anthracis str. A0442      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−IATVVFFAIFFAVVDMGIS
fig|526970.3.peg.2855   Bacillus cereus BGSC 6E1      NFFGDVGREMKKVSWPK−−−−−−−−−−−KDELLRSTATV−−−−IATVVFFAIFFAVVDMGIS
fig|403833.7.peg.378   Petrotoga mobilis SJ95       FLTSVWQEAKKINWPT−−−−−−−−−−−RKELLNSTLVV−−−−LIVIAIFAVYLFAVDFGL 
fig|391896.3.peg.313   Rickettsia bellii OSU 85-389      KFFEQVKQEAYKVVWPT−−−−−−−−−−−KKELTASTLVV−−−−IVAVFVFSLICLVLDYGI 
fig|1003201.3.peg.127   Rickettsia typhi str. TH1527      KFFEQVKQETYKVFWPN−−−−−−−−−−−RKELIASTLVV−−−−VAAVFIFSLICLVLDYSI 
fig|257363.4.peg.129   Rickettsia typhi str. Wilmington      KFFEQVKQETYKVFWPN−−−−−−−−−−−RKELIASTLVV−−−−VAAVFIFSLICLVLDYSI 
fig|452659.4.peg.211   Rickettsia rickettsii str. Iowa      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLTCLVLDYSI 
fig|293613.3.peg.148   Rickettsia canadensis str. McKiel      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|272944.4.peg.204   Rickettsia conorii str. Malish 7      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|272951.4.peg.602   Rickettsia sibirica 246      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|1105114.3.peg.1073   Rickettsia montanensis str. OSU 85-930      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|315456.7.peg.1388   Rickettsia felis URRWXCal2      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|315456.3.peg.1152   Rickettsia felis URRWXCal2      KFFEQVKQETYKVVWPT−−−−−−−−−−−RKELVASTLVV−−−−VVAVFIFSLICLVLDYSI 
fig|292459.1.peg.2963   Symbiobacterium thermophilum IAM 14863       YLREVVGELRKVVWPS−−−−−−−−−−−RERVIKATGIV−−−−VAMVALVAGFLYLWDLGIG
fig|292459.5.peg.3071   Symbiobacterium thermophilum IAM 14863       YLREVVGELRKVVWPS−−−−−−−−−−−RERVIKATGIV−−−−VAMVALVAGFLYLWDLGIG
fig|309807.25.peg.1831   Salinibacter ruber DSM 13855      EYLENVVAEMEKVNWPG−−−−−−−−−−−RDELISSTLIT−−−−IVATLIVSGFIFLADQVIQ
fig|518766.7.peg.1111   Rhodothermus marinus DSM 4252       YLQEVYREMQKVSWPS−−−−−−−−−−−RQELINNTILT−−−−LVASTVLALFIFLADRVIA
fig|517417.5.peg.1892   Chlorobaculum parvum NCIB 8327      KYYRDVVSEMRKVSWPT−−−−−−−−−−−RDEVKDMTVVV−−−−LTVSGILALFTFSVDWVIS
fig|194439.1.peg.149   Chlorobium tepidum TLS      KYYRDVVGEMRKVSWPT−−−−−−−−−−−REEVKDMTIVV−−−−LTVSGILALFTFVVDWVIS
fig|290512.6.peg.296   Prosthecochloris aestuarii DSM 271      RYYHDVLNEMRKVSWPS−−−−−−−−−−−RDEVKDLTLVV−−−−LTVSGALAVFTFVVDWAIT
fig|517418.3.peg.1380   Chloroherpeton thalassium ATCC 35110     VKYYSDVVTEMRKVTWPS−−−−−−−−−−−QEELKDATIVV−−−−LSVSGILAVFTFSVDWII 
fig|290315.5.peg.216   Chlorobium limicola DSM 245      QYYRDVVSEMRKVAWPS−−−−−−−−−−−KEEAKDLTVVV−−−−LTVSGILALFTFVVDWVI 
fig|290317.9.peg.266   Chlorobium phaeobacteroides DSM 266      QYYRDVVSEMRKVVWPG−−−−−−−−−−−KDELKDLTIVV−−−−LTVSGILALFTFLVDWVI 
fig|324925.4.peg.2852   Pelodictyon phaeoclathratiforme BU-1      QYYRDVISEMRKVIWPS−−−−−−−−−−−KEEIKDLTIVV−−−−LTVSGILALFTFLVDWVI 
fig|290318.4.peg.1592   Prosthecochloris vibrioformis DSM 265      QYYRDVVNEMRKVVWPG−−−−−−−−−−−KEEIKDLTVVV−−−−LTVSGLLALFTFVVDWVIG
fig|377431.3.peg.2288   Chlorobium ferrooxidans DSM 13031      QYYRDVINEMRKVVWPG−−−−−−−−−−−KEEIKDLTIVV−−−−LTVSGILALFTFLVDWVI 
fig|340177.8.peg.360   Chlorobium chlorochromatii CaD3      QYYRDVVVEMRKVVWPT−−−−−−−−−−−KQELKDLTVVV−−−−LTVSGILALFTFLVDWVI 
fig|319225.5.peg.2045   Chlorobium luteolum DSM 273      QYYRDVVAEMRKVVWPS−−−−−−−−−−−KEELKDLTVVV−−−−LTVSGLLALFTFLVDWVI 
fig|316274.7.peg.122   Herpetosiphon aurantiacus ATCC 23779      QFFRDAFSEMRKVVWPS−−−−−−−−−−−REETQRLTLVVIGISLLVGSILAVFDLLF     
fig|316274.3.peg.122   Herpetosiphon aurantiacus ATCC 23779      QFFRDAFSEMRKVVWPS−−−−−−−−−−−REETQRLTLVVIGISLLVGSILAVFDLLF     
fig|357808.5.peg.3680   Roseiflexus sp. RS-1     VQPLRESRAEMRKVVWPT−−−−−−−−−−−REETIRLTVVV−−−−ILLSAIMSAILFAADALFS
fig|383372.6.peg.4807   Roseiflexus castenholzii DSM 13941     VQPLRESRAEMRKVVWPT−−−−−−−−−−−REETIRLTVVV−−−−ILLSAVMSAILFAADALFS
fig|629741.3.peg.40   Kingella oralis ATCC 51147     FRYIKDSVAEVKKVVWPS−−−−−−−−−−−RSDTVRMTMFV−−−−IAFTCVFAIFIYGVDTLIG
fig|641147.3.peg.1705   Simonsiella muelleri ATCC 29453       YIRESIIEFKKVVWPK−−−−−−−−−−−RPEAVRMTMFV−−−−MVFVAVFGTFIYGVDSLIS
fig|546264.5.peg.1252   Neisseria flavescens NRL30031/H210     FAYFKSSWTEFKKVVWPS−−−−−−−−−−−RDEAVKMTVFV−−−−IIFVAVLAAFIYAADTIIS
fig|596320.3.peg.1766   Neisseria flavescens SK114     FAYFKSSWTEFKKVVWPS−−−−−−−−−−−RDEAVKMTVFV−−−−IIFVAVLAAFIYAADTIIS
fig|546268.4.peg.2231   Neisseria subflava NJ9703     FAYFKSSWTEFKKVVWPS−−−−−−−−−−−RDEAVKMTVFV−−−−IIFVAVLAAFIYTADTIIS
fig|641149.3.peg.2606   Neisseria sp. oral taxon 014 str. F0314      SYFKNSWSEFKKVVWPT−−−−−−−−−−−RDDAVKMTIFV−−−−VIFVAILAVFIYAADSAIS
fig|546266.6.peg.1245   Neisseria mucosa ATCC 25996      SYFRNSWSEFKKVVWPA−−−−−−−−−−−RDDAVKMTIFV−−−−VIFVSILAVFIYAADSAIS
fig|547045.3.peg.2286   Neisseria sicca ATCC 29256      SYFKNSWSEFKKVVWPT−−−−−−−−−−−RDDAVKMTVFV−−−−VIFVAILAVFIYAADSAIS
fig|546267.4.peg.2130   Neisseria polysaccharea ATCC 43768     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−RENAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|546262.4.peg.1694   Neisseria cinerea ATCC 14685     FAYFSNSWLEFKKVVWPK−−−−−−−−−−−REDAVKMTMFV−−−−IVFVAVLSIFIYAADTAIS
fig|1145133.3.peg.144   Neisseria meningitidis 64182     FAYFSNSWFEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|528360.6.peg.2187   Neisseria gonorrhoeae SK-93-1035     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|1069612.3.peg.65   Neisseria meningitidis NM183     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|1079754.3.peg.938   Neisseria meningitidis Nm6938     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|940296.3.peg.2413   Neisseria gonorrhoeae TCDC-NG08107     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|546265.5.peg.2191   Neisseria lactamica ATCC 23970     FAYFSNSWSEFKKVVWPK−−−−−−−−−−−REDAVRMTVFV−−−−IVFVAVLSIFIYAADTAIS
fig|497964.5.peg.5715   Chthoniobacter flavus Ellin428      SFVSEVKVELQKASWPW−−EPKEKGMKKYKELVDSTLIV−−−−VIAMLLLSGYIAGWEFLLQ
fig|481448.7.peg.835   Methylacidiphilum infernorum V4     KAFIGEVVVELKKCSWPW−−DPKEKGIRKYKELIDSTLAV−−−−TIYSIILAAVVTSADFIL 
fig|349741.3.peg.1118   Akkermansia muciniphila ATCC BAA-835      QFIAEVKGELKKTTWPWESDPKVKGFKKFRELWGSTLVV−−−−LIAMVFLGAFVASFDIFL 
fig|240016.6.peg.5340   Verrucomicrobium spinosum DSM 4136      RYLSEVWGEMKKATWPW−−DPKEKGFARYKELTDATTVV−−−−FVAMLIFAGFTGAFDFVMR
fig|320771.5.peg.2295   bacterium Ellin514      NYIQETREELKKCTWPT−−−−−−−−−−−WAELKGSTLVV−−−−MICIALIAIFTIVVDFVFA
fig|583355.3.peg.2685   Coraliomargarita akajimensis DSM 45221       FYKETLTELKKASWPT−−−−−−−−−−−KTELRDSTVVV−−−−LLATAILGSFIALTDFSL 
fig|456827.3.peg.440   Cloacamonas acidaminovorans      RFFRDVRSEMKCVSWPT−−−−−−−−−−−KTDLKEGTLVV−−−−IIMSAIVAIFLSLIDFGFT
fig|546414.3.peg.688   Deinococcus deserti VCD115     IQYFRDSRAELSRVSWPS−−−−−−−−−−−RQQVLDGTQAV−−−−LIFVVALTLIVFALDLLFS
fig|243230.1.peg.2230   Deinococcus radiodurans R1     IQYFRDAREELSRVTWPS−−−−−−−−−−−RQDVLEGTQAV−−−−LIFVVALTLIVWALDLLFG
fig|68909.1.peg.947   Deinococcus geothermalis DSM11300     MQYLRDSREELARVTWPT−−−−−−−−−−−RQQVIDGTQAV−−−−LIFVIALTLIVFVMDFVFG
fig|649638.3.peg.2491   Truepera radiovictrix DSM 17093      RYLRNSRAELGRVTWPT−−−−−−−−−−−RQEVVQSTQAT−−−−LIFVLITSLFLLATDTVLG
fig|526227.4.peg.2463   Meiothermus silvanus DSM 9946     VNYFRESRAELSRVTWPT−−−−−−−−−−−RQEIVQSTEVI−−−−LLVTVFFMVVLGLYDLVFR
fig|504728.5.peg.2400   Meiothermus ruber DSM 1279     INYFREARAELTRVTWPS−−−−−−−−−−−RQEVIESTQVI−−−−LVFAVVAMVVLGLIDTIFR
fig|445337.5.peg.2462   Clostridium botulinum C str. Eklund      KFLKELKAETKRITWPP−−−−−−−−−−−KEEVKKSTIIV−−−−LFFCVVSAFIIGLMDSGF 
fig|929508.3.peg.2245   Clostridium botulinum V891     VKFLKELKAETKRITWPP−−−−−−−−−−−KEQTKKSTIIV−−−−LFFCAVSAIIIGLMDSGFS
fig|386415.6.peg.211   Clostridium novyi NT      KFLKELKAETKRITWPP−−−−−−−−−−−KEEVKKSTIIV−−−−LFFCAVSAFIIGLMDSGF 
fig|123214.3.peg.1206   Persephonella marina EX-H1     IKFLKEVREELKKVTWPS−−−−−−−−−−−KQLVRTATIAV−−−−IVFTLIVSVYLWGLDILF 
fig|204536.4.peg.1714   Sulfurihydrogenibium azorense Az-Fu1     INFLKEVYEELKKVTWPS−−−−−−−−−−−RELVKTATATV−−−−IVFTLIIAVYLWGLDLLFA
fig|608538.3.peg.876   Hydrogenobacter thermophilus TK-6     KSFIKGVRQEVDRVTWPD−−−−−−−−−−−RKLVTKATISV−−−−IIFSLLIGVYLWLLDVGFT
fig|547144.3.peg.256   Hydrogenobaculum sp. HO      SFLKEVRQELRKVSWPD−−−−−−−−−−−KKLVIRATVSV−−−−IIFSLFFGIYLWIVDLSFT
fig|469383.5.peg.1322   Conexibacter woesei DSM 14684      NFLRGSWRELQRVQWPD−−−−−−−−−−−RKQVTSATAVV−−−−IGFVLLSGAFLGAADWV  
fig|379066.3.peg.875   Gemmatimonas aurantiaca T-27     VTFYHEVIAEMKKVTWPD−−−−−−−−−−−RPQLQQATIQI−−−−IIFVLVLGAVIGLVDVALQ
fig|266117.6.peg.1919   Rubrobacter xylanophilus DSM 9941     KRFVREVRAELGRVTWPD−−−−−−−−−−−REQLQQSTAVV−−−−LIIVLLLTAYIAAWDFVFQ
fig|572547.3.peg.325   Aminobacterium colombiense DSM 12261      SFVREAKAELKKVTWPG−−−−−−−−−−−KKQVWYSTLVV−−−−IAFTLFVAAYLGIVDLALT
fig|469381.5.peg.446   Dethiosulfovibrio peptidovorans DSM 11002     FGFIREARAELKKVTWPG−−−−−−−−−−−KQQVWYSTLVV−−−−IFVTLLVAVYLGIVDMALT
fig|525903.6.peg.1506   Thermanaerovibrio acidaminovorans DSM 6589     IDFLREARGELKKVAWPT−−−−−−−−−−−RQQVWYSTLVV−−−−LFVTFAVSAYLGLVDAVLT
fig|592015.5.peg.267   Anaerobaculum hydrogeniformans ATCC BAA-1850     MNFLREARAELRRVTWPN−−−−−−−−−−−RKQVWISTLLV−−−−IGVTLLVSAYLGVLDLIFT
fig|645512.3.peg.891   Jonquetella anthropi E3_33 E1       FIRESRAEFKKITWPT−−−−−−−−−−−RKQVWYSTLVV−−−−IAVTLLLSAYLGILDLILT
fig|883.3.peg.1545   Desulfovibrio vulgaris str. 'Miyazaki F'       YFEEAKGELRKVTWPT−−−−−−−−−−−RKETTATGIAV−−−−LVLVFVMSLFLGVVDLGLT
fig|391774.8.peg.615   Desulfovibrio vulgaris DP4       YVEEAKVELRKVSWPT−−−−−−−−−−−RKEAWATSMTV−−−−LVFVFVMSLFLGFVDLGLT
fig|207559.3.peg.3079   Desulfovibrio desulfuricans G20     KEFLEESKVEIRKVTWPS−−−−−−−−−−−RKETTATSIAV−−−−LVLVFVMSLFLGIVDLGLT
fig|363253.5.peg.1013   Lawsonia intracellularis PHE/MN1-00     KNYLELSYFELKKVTWPT−−−−−−−−−−−FKETKTTSLIV−−−−LVFVSIMSIFLGLVDLGLS
fig|525146.4.peg.1890   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774      RYVEDAKAELRKVTWPT−−−−−−−−−−−VKETRKATLAV−−−−LGFVAVMAVILGLVDLGLS
fig|411464.8.peg.219   Desulfovibrio piger ATCC 29098      QYIEDSRGELRKVTWPT−−−−−−−−−−−LKETRKATFAV−−−−LGFVAVMAIVLGLVDLGLS
fig|643562.6.peg.2301   Desulfovibrio aespoeensis Aspo-2     IEFLEESKVEIKKVVWPT−−−−−−−−−−−RKETITTCVAV−−−−LIVSLVVALYLGIVDLALS
fig|644968.4.peg.1398   Desulfovibrio sp. FW1012B      EFFEQSKVELKKVTWPT−−−−−−−−−−−RQETVKTGIAV−−−−LVFSVVMAIYLGVVDMALS
fig|573370.3.peg.2991   Desulfovibrio magneticus RS-1     KEFFEQAKGELRKVTWPT−−−−−−−−−−−REETVKTGIAV−−−−LVFSVVMAIYLGVVDMALS
fig|485915.4.peg.2474   Desulfohalobium retbaense DSM 5692     KEFFEESQVELKKVTWPT−−−−−−−−−−−RKETLQMSGTV−−−−LLFVAVLALFLGLVD    
fig|522772.5.peg.2054   Denitrovibrio acetiphilus DSM 12809      KFYNEVKEELKKVVWPT−−−−−−−−−−−KESTIGTTGVV−−−−IAICIVCAIFMGVVDFGLA
fig|639282.3.peg.1789   Deferribacter desulfuricans SSM1     KKFIQEVKEELKKVVWPT−−−−−−−−−−−KQETIQTTIVV−−−−IVMTLIVSAFLGVVDVALS
fig|555779.3.peg.1229   Desulfonatronospira thiodismutans ASO3-1     KEYLEEVKGELKKVTWPT−−−−−−−−−−−RKETLSTALAV−−−−VALVIIVSIYLGIADFIFS
fig|243231.1.peg.2849   Geobacter sulfurreducens PCA     KEFLTEVKAELDKVTWPT−−−−−−−−−−−RKETVSTTWVV−−−−VAIVLLISVYLGVCDVVLA
fig|398767.5.peg.1290   Geobacter lovleyi SZ     KTFFESVKLELSKVTWPT−−−−−−−−−−−RKETVATTGVV−−−−IMIVFMVSIYLGLCDVVLS
fig|335543.9.peg.1804   Syntrophobacter fumaroxidans MPOB      QYLREVVSELKKVVWPS−−−−−−−−−−−RKETVGSTAVV−−−−LVIVAVCGVFLGIVDQVLS
fig|96561.3.peg.696   Desulfococcus oleovorans Hxd3     VQFLREVKVELKKVTWPT−−−−−−−−−−−RQQTIGSTAVV−−−−LLLVMIISVFLGLADLVLG
fig|439235.4.peg.2052   Desulfatibacillum alkenivorans AK-01     VQFLREVRGELKKVTWPS−−−−−−−−−−−RKQTVGSTAVV−−−−IILVAVISMFLGLVDMGLT
fig|177437.4.peg.3743   Desulfobacterium autotrophicum HRM2     VRFFREVRVELKKVTWPN−−−−−−−−−−−QKQTAGSTVVV−−−−IILVFILAAFLGLVDFGLS
fig|281689.4.peg.2714   Desulfuromonas acetoxidans DSM 684      GFLGNVKSELIKVTWPT−−−−−−−−−−−RKDTYASTVVV−−−−IAFVLLVAVFLWGVDNILS
fig|682634.3.peg.4857   Serratia odorifera 4Rx13     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|300267.13.peg.4442   Shigella dysenteriae Sd197     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1232150.3.peg.1886   Escherichia coli O26:H11 str. CFSAN001629     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|290338.8.peg.2524   Citrobacter koseri ATCC BAA-895     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1116155.3.peg.4676   Escherichia coli P0302308.3     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|992171.3.peg.4054   Yersinia pestis PY-89     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|399742.10.peg.319   Enterobacter sp. 638     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|615.1.peg.3480   Serratia marcescens Db11     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1166016.3.peg.217   Pectobacterium sp. SCC3193     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|12149.1.peg.4116   Salmonella bongori 12149     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|377628.5.peg.362   Yersinia pestis Nepal516     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|300268.10.peg.4737   Shigella boydii Sb227     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|399741.3.peg.298   Serratia proteamaculans 568     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1211025.3.peg.221   Enterobacter cloacae subsp. cloacae ENHKU01     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1169322.3.peg.4860   Citrobacter sp. KTE151     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|399741.7.peg.312   Serratia proteamaculans 568     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|667129.3.peg.916   Serratia odorifera DSM 4582     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|216598.1.peg.2697   Shigella dysenteriae M131649     VAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|198215.9.peg.2687   Shigella flexneri 2a str. 2457T     IAFAREARTEVRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|215689.3.peg.1440   Erwinia sp. Ejp617       FAREARTEVRKVVWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1255307.3.peg.234   Erwinia amylovora CFBP 1232       FAREARTEVRKVVWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|465817.9.peg.194   Erwinia tasmaniensis Et1/99       FAREARTEVRKVVWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|592316.3.peg.5387   Pantoea sp. At-9b     VAFAREARTEMRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|706191.3.peg.222   Pantoea ananatis LMG 20103     VAFAREARTEMRKVIWPT−−−−−−−−−−−RQETLHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|1027364.3.peg.1804   Edwardsiella tarda DT     VAFAREARTEMRKVIWPT−−−−−−−−−−−RQEALHTTLIV−−−−AAVTAVMALILWGLDGIL 
fig|243265.1.peg.410   Photorhabdus luminescens subsp. laumondii TTO1       FAREARIEMRKVIWPT−−−−−−−−−−−RQEALHTTLIV−−−−AAVTALMSLILWGLDGIL 
fig|406818.4.peg.3667   Xenorhabdus bovienii SS-2004       FAREARVEMRKVIWPT−−−−−−−−−−−RQEALHTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|521000.6.peg.1225   Providencia rettgeri DSM 1131       FAREARVEMRKVIWPT−−−−−−−−−−−RQETLQTTLIV−−−−AAVTAVMSLILWGLDGIL 
fig|572265.5.peg.724   Hamiltonella defensa 5AT (Acyrthosiphon pisum)      EFAREARIEMRKVIWPT−−−−−−−−−−−RQETLQTTLIV−−−−ALITLVMSLILWGIDSIL 
fig|529507.6.peg.2722   Proteus mirabilis HI4320       FAREARIEMRKVVWPT−−−−−−−−−−−RQETLQTTLIV−−−−AAVTAIVSLVLWGLDGIL 
fig|471881.3.peg.1678   Proteus penneri ATCC 35198       FAREARIEMRKVVWPT−−−−−−−−−−−RQETLQTTLIV−−−−AAVTAIVSLVLWGLDGIL 
fig|1128912.3.peg.2337   Glaciecola mesophila KMM 241       FAKDARTEVRKVVWPT−−−−−−−−−−−RQEATQTTIIV−−−−LVATAFMSLVLWGLDLII 
fig|326442.8.peg.207   Pseudoalteromonas haloplanktis TAC125       FAKEARIEVRKVIWPT−−−−−−−−−−−RQETIHTTLIV−−−−MVATAIMALILWGLDGIL 
fig|156578.3.peg.106   Alteromonadales bacterium TW-7       FAKEARIEVRKVIWPT−−−−−−−−−−−RQETTHTTLIV−−−−MVATVIMALILWGLDGIL 
fig|675814.3.peg.53   Vibrio coralliilyticus ATCC BAA-450     IEFAKESRMEVRKVVWPT−−−−−−−−−−−RQETVQTTLIV−−−−LAVSIVMALALWGIDGIM 
fig|675816.3.peg.4152   Vibrio orientalis CIP 102891     IEFAKESRMEVRKVVWPT−−−−−−−−−−−RQETMQTTLIV−−−−LAVSIVMALVLWGIDGIM 
fig|338187.4.peg.205   Vibrio harveyi ATCC BAA-1116     ISFAKESRMEVRKVVWPT−−−−−−−−−−−RQETMQTTLIV−−−−LAVSIVMALALWGIDGIM 
fig|674977.3.peg.1547   Vibrio alginolyticus 40B     ISFAKESRMEVRKVVWPT−−−−−−−−−−−RQETMQTTLIV−−−−LAVSIVMALVLWGIDGIM 
fig|1229493.3.peg.5573   VIbrio owensii CAIM 1854 = LMG 25443     ISFAKESRMEVRKVVWPT−−−−−−−−−−−RQETMQTTLIV−−−−LAVSIVMALVLWGIDGIM 
fig|1231058.3.peg.3995   Vibrio alginolyticus E0666     ISFAKESRMEVRKVVWPT−−−−−−−−−−−RQETMQTTLIV−−−−LAVSIVMALVLWGIDGIM 
fig|316275.9.peg.3004   Aliivibrio salmonicida LFI1238     IEFARESRMEVRKVVWPT−−−−−−−−−−−RQETTQTTFIV−−−−LAVCIVMALILWGIDGIM 
fig|617135.3.peg.1961   Aliivibrio fischeri ZF-211     IAFARESRMEVRKVVWPT−−−−−−−−−−−RQETTQTTFIV−−−−LAVCIVMALILWGIDGIM 
fig|591023.4.peg.372   Actinobacillus minor 202     IGFAKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSLI 
fig|416269.5.peg.1634   Actinobacillus pleuropneumoniae L20     IGFIKEARTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|1316932.3.peg.374   Mannheimia haemolytica M42548     IHFIKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|434271.4.peg.1743   Actinobacillus pleuropneumoniae serovar 3 str. JL03     IGFIKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|228399.1.peg.1231   Actinobacillus pleuropneumoniae serovar 1 str. 4074     IGFIKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|228399.4.peg.1341   Actinobacillus pleuropneumoniae serovar 1 str. 4074     IGFIKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|754259.3.peg.1794   Actinobacillus pleuropneumoniae serovar 10 str. D13039     IGFIKESRTELRKIIWPT−−−−−−−−−−−RPEATQTTLIV−−−−LAMCVVVSLVLWGIDSII 
fig|314277.4.peg.3032   Marinomonas sp. MED121         REAKTEIRRVVWPT−−−−−−−−−−−RQETVQTTLIV−−−−LAVVIFMSLVLWGVDSFLG
fig|360115.5.peg.348   Coxiella burnetii RSA 331      GFIKNARAELRKVVWPT−−−−−−−−−−−RQETLRTTLVV−−−−IVMVVITALILWGLDSFF 
fig|227377.7.peg.218   Coxiella burnetii RSA 493      GFIKNARTELRKVVWPT−−−−−−−−−−−RQETLQTTLVV−−−−IVMVVITALILWGLDSFF 
fig|314283.3.peg.1728   Reinekea sp. MED297         KEAWVEVRKVVWPT−−−−−−−−−−−RQETVQTTLVV−−−−IGFVLVVALILWAVDSLLG
fig|565045.3.peg.408   gamma proteobacterium NOR51-B        VKGARTEIRKVVWPT−−−−−−−−−−−RQETTQTTLIV−−−−VVFVIVMALILWALDSLLG
fig|247639.3.peg.215   marine gamma proteobacterium HTCC2080      QLIKGSRTEIRKVVWPT−−−−−−−−−−−RQETTQTTLIV−−−−VVFVFIMALILWGIDSVLG
fig|472759.3.peg.2498   Nitrosococcus halophilus Nc4      SFAGETRTEFRKVVWPS−−−−−−−−−−−RQETIRTTLIV−−−−LLMVMVMASILWLFDTLL 
fig|187272.6.peg.421   Alkalilimnicola ehrlichii MLHE-1      QFARASRQELRKVVWPN−−−−−−−−−−−RQETLQTTLIV−−−−FVMVVLVALFLWLVDLL  
fig|290398.11.peg.422   Chromohalobacter salexigens DSM 3043         RGSRKEIRRVVWPT−−−−−−−−−−−RPETIQTTAIV−−−−LVAVLLVGIMLWLIDTLLG
fig|59196.3.peg.1032   Rickettsiella grylli       FAQASRAELRKVVWPT−−−−−−−−−−−REETIRTTLIV−−−−IVMVIVAGLFLWAIDTLL 
fig|1217668.3.peg.2289   Acinetobacter lwoffii NIPH 478     IRLLKDARIELRRVTWPT−−−−−−−−−−−KQETMSTSWQV−−−−LVVVVIASILLWCFDYILG
fig|62977.3.peg.716   Acinetobacter sp. ADP1     IRLLKDARIELRRVTWPT−−−−−−−−−−−KQETVTTSWQV−−−−LLVVVITSIVLWCFDYGLG
fig|1217671.3.peg.2122   Acinetobacter parvus NIPH 1103     VRLLQDARIELRRVTWPT−−−−−−−−−−−KQETITTSWQV−−−−LLVVIIASLVLWCFDYGLG
fig|413404.11.peg.903   Ruthia magnifica str. Cm (Calyptogena magnifica)      SFLIETKIELRKVVWPT−−−−−−−−−−−RDETIKTTGMI−−−−MVAVVIVAIFLWIVDMLLS
fig|317025.3.peg.251   Thiomicrospira crunogena XCL-2     FSYLSHAQKEVKQVIWPT−−−−−−−−−−−RQETVQMTLIV−−−−FAVVIVMSIFLWLVDMFF 
fig|383631.3.peg.9   Methylophilales bacterium HTCC2181     IGFLNDAITEAKKVVWPT−−−−−−−−−−−RKETFQMTLIV−−−−FILVVLMAIFLAFVDIGFS
fig|314607.3.peg.1153   beta proteobacterium KB13     FTFLNSVVLEAKKVVWPT−−−−−−−−−−−RKETVQMTLVV−−−−FVVVVLMAIFLALVDIGFT
fig|666681.3.peg.321   Methylotenera sp. 301       FIGEAVAEARKVVWPT−−−−−−−−−−−RKETTQTTMVV−−−−FVLVVIMAAFLAVVDIGFA
fig|582744.3.peg.290   Methylovorus sp. SIP3-4     FAFVQDSAAEARRVVWPT−−−−−−−−−−−RKETIQTTVAV−−−−FVLVMVMAVFLWLVDIGF 
fig|265072.7.peg.268   Methylobacillus flagellatus KT     ISFAREAVLETRKVVWPT−−−−−−−−−−−RKETIQTTAAV−−−−FGLVIIMAIFLWIVDVGF 
fig|335283.9.peg.2193   Nitrosomonas eutropha C91     FSFFKDSIEEVKKVVWPT−−−−−−−−−−−KKETLQTSGVV−−−−CAFVITMAFFLWIVDSGL 
fig|228410.6.peg.2302   Nitrosomonas europaea ATCC 19718     FLFF