(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020466

fig|1294271.3.peg.712   Staphylococcus epidermidis 41tr     MKIKRYALLCLLGGLVGGIIGYIIGAINWEKLFNYAQFANFKVVLYTTIVASLINIILTVYLFIVQNASLHYKAKID−−−ANISDDLADTYENKSYIKSLKVRFIYTMQLIVAFIA−−−ILI−−−−−−−−−−−−−−PVIGNASENHIALIMIPFIITIISSIMIGIFYRKFDARYPKLGEKRYTEKAFNIMDEGERYITLVSSYKVHQQNIVLLFIGIMTLGIFSITTGMNQSLGIILFIILFIYNSLGYLLKVSNFYK
fig|904341.3.peg.936   Staphylococcus epidermidis VCU125     MKIKRYALLCLLGGLVGGIIGYIIGAINWEKLFNYAQFANFKVVLYTTIVASLINIILTVYLFIVQNASLHYKAKID−−−ANISDDLADTYENKSYIKSLKVRFIYTMQLIVAFIA−−−ILI−−−−−−−−−−−−−−PVIGNASENHIALIMIPFIITIISSIMIGIFYRKFDARYPKLGEKRYTEKAFNIMDEGE                                                                 
fig|979209.3.peg.2272   Staphylococcus epidermidis NIHLM039     MKIKRYALLCLLGGLVGGIIGYIIGAINWEKLFNYAQFANFKVVLYTTIVASLINIILTVYLFIVQNASLHYKAKID−−−ANISDDLADTYENKSYIKSLKVRFIYTMQLIVAFIA−−−ILI−−−−−−−−−−−−−−PVIGNASENHIALIMIPFIITIISSIMIGIFYRKFDARYPKLGEKRYTEKAFNIMDEGERYITLVSLYKVHQQNIVLLFIGIMTLGIFSITTGMNQSLGIILFIILFIYNSLGYLLKVSNFYK
fig|176280.1.peg.2387   Staphylococcus epidermidis ATCC 12228                                                 LYTTIVASLINIILTVYLFIVQNASLHYKAKID−−−ANISDDLADTYENKSYIKSLKVRFIYTMQLIVAFIA−−−ILI−−−−−−−−−−−−−−PVIGNASENHIALIMIPFIITIISSIMIGIFYRKFDARYPKLGEKRYTEKAFNIMDEGERYITLVSLYKVHQQNIVLLFIGIMTLGIFSITTGMNQSLGIILFIILFIYNSLGYLLKVSNFYK
fig|979211.3.peg.997   Staphylococcus epidermidis NIHLM023     MKIKRYALLCLLGGLVGGIIGYIIGAINWEKLFNYAQFANFKVVLYTTIVASLINVILTVYLFIVQNASLHYKAKID−−−ANISDDLADTYENKSYTKSLKVRFIYTMQLIVAFIA−−−ILI−−−−−−−−−−−−−−PVIGNASENHIALIMIPFIITIISSIMIGIFYRKFDARYPKLGEKHYTEKAFNIMDEGERYITLVSLYKVHQQNIVLLFIGIMMLGIFSITTGMNQSLGIILFIILFTYNSLGYLLKVSNFYK
fig|435838.3.peg.1745   Staphylococcus caprae C87     MKVGRYILLTLIGGIIGGLIGLSFGGIKILSLTPFTHFAKTNVVIIIATISSIINILLTLYLFKVHKDALNLKVKTR−−−NHIDDESADLYEKKAFLKSMKSDFIYSIQILISLLT−−−ILI−−−−−−−−−−−−−−VVLGNASAKNIMFVIIPYVITIIPALMIGFFIRKFDPRYPKLGEKNYIEKTLNLFDEGERHITLIAMYKLYRVNISLIIGGCLIVGLFSISTGINQTLSLIVLIILFVYNTFGYLTKINKFYK
fig|525378.3.peg.1879   Staphylococcus epidermidis M23864:W1     MKVGRYLLLILIGGVIGGFIGMSIGVINTNNLLRITHFSNVKTVLIIVGLATIINIILTLYLYIIQNNALKYKKKVT−−−EDIEDDLVDYYEKSANLNFNKAHIIYYVELIISFIS−−−LFF−−−−−−−−−−−−−−IVLGNGNDKVLLYALIPYLFTIIPSLMIGFFVQKFDPRYPKLGEKNYTEKVLNLYDEGEKHIILQSMYKVFCINIYLLMTGIIILGFFSLATNENQTIGVFILIILFIYNIYTYFSKLIRFYK
fig|1034809.4.peg.290   Staphylococcus lugdunensis N920143                                        TNFSGSRLNLIICVSTSLLILALMLYQWYVQQRSLKYKYMIS−−−NVDDGSDIDHYEKQATLDYNKVHIIAHLQLAIGFIA−−−IFF−−−−−−−−−−−−−−IALGNAAPNEFFYALIPYLLTLIPSLMLGFYSRRFDARLPKIAEKHYTEKALALLDDGERHIVLISMYKNYQVNIVLLIMAIVFIGIFSIYTGLNQTPGLLALIVIFIYNSLGYLIKLRQFYK
fig|698737.3.peg.290   Staphylococcus lugdunensis HKU09-01                                        TNFSGSRLNLIICVSTSLLILALMLYQWYVQQRSLKYKYMIS−−−NVDDGSDIDHYEKQATLDYNKVHIIAHLQLAIGFIA−−−IFF−−−−−−−−−−−−−−IALGNAAPNEFFYALIPYLLTLIPSLMLGFYSRRFDARLPKIAEKHYTEKALALLDDGERHIVLISMYKNYQVNIVLLIMAIVFIGIFSIYTGLNQTPGLLALIVIFIYNSLGYLIKLRQFYK
fig|883164.3.peg.1648   Staphylococcus lugdunensis ACS-027-V-Sch2                                        TNFSGSRLNLIICVSTSLLILALMLYQWYVQQRSLKYKYMIS−−−NVDDGSDIDHYEKQATLDYNKVHIIAHLQLAIGFIA−−−IFF−−−−−−−−−−−−−−IALGNAAPNEFFYALIPYLLTLIPSLMLGFYSRRFDARLPKIAEKHYTEKALALLDDGERHIVLISMYKNYQVNIVLLIMAIVFIGIFSIYTGLNQTPGLLALIVIFIYNSLGYLIKLRQFYK
fig|279808.8.peg.301   Staphylococcus haemolyticus JCSC1435     MKVKRYLILLVLGGIIGGFVGSSMGSIS−−NFLSNVNFAHTHFGLIICIIASLIIIGLTFYLWKVQKDALKFKNQSL−−−NSIEDDDADLFEMKSNLNFNKSSIIIYIQLIISFVA−−−LLL−−−−−−−−−−−−−−IVFGHGSNSDVLYAIIPYMLTIIPSIMLGFFNRRFDSRYPKIGEKNYTEKTLALLDEGERHIAIVSMYKNYGVNLVLLMIAIIFLSIFSIDTGSNQTLGILFLIIIFAYNSLGYMLKVRKFYK
fig|596319.3.peg.1506   Staphylococcus warneri L37603     MKVGRYLLLMIIGGIVGGIAGLLIPTLHNLGIFDKTHFTSQNFIIVSCIIATLINIILTIFLYIELKHSVDLKNKIA−−−EPNSNVDEDIFEEKSSLKFINASFIYYLQILISLLF−−−LFT−−−−−−−−−−−−−−LVIGNVSDIYTLYSIILYMITMIPSIMIGLYARKIDNRYPKLGEANYTEKTLSIMDEGERYITLTSMFKTYHINLVLIIIFAVFLSVHSINTGINQTLGVLFLIILFIYNAFGYLSKVRKFYK
fig|629742.3.peg.1405   Staphylococcus hominis SK119     MKIGRFIITLLIGGLIGGCIALFIDYNHSFHFFGNYHYATHSNVILISLICVALILVLSMYLIMIQKKAVHYKRLSE−−−THIDEDEADSYDKKANLAYMQNSFIYYLELTISFIA−−−LFI−−−−−−−−−−−−−−IVLGNGNSSASSWALLPFMTMIISSVITGLFYRKFDSRYPKLGEKNYAEKLINILDEGERHIYFNSLFKTFYINLSLIMIGAIFLGFYSLETGHSQTLGIFILIILFIYNGFSHLLKTYKFY 
fig|585145.3.peg.329   Staphylococcus aureus subsp. aureus 65-1322     MKILRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATHNNVVVISIIATIIIILIEIIVLMNQRRALKYKRLVD−−−EEVDNEETDQYELLANRHVLNGSILSILQTVIALLV−−−LLI−−−−−−−−−−−−−−FVVGQAEVNGILLFLIPFFASAIFNTQFTLFNRRFDDRMPKIADKNYTEKRLEILDEGEHHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|273036.3.peg.314   Staphylococcus aureus RF122     MKVLRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATRNNVVVISIVATMIIILIEIIVLMNQRRALKYKRLVD−−−EEVDNEETDQYELLANRHVLNGSILSILQTVIALLV−−−LLI−−−−−−−−−−−−−−FVVGQAEANGILFFLIPFFASGIFNTQFTLFNRRFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKSRRFY 
fig|1158485.3.peg.155   Staphylococcus aureus M1311     MKILRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATRNNVVVISIIATMIIILIEIIVLMNQRRALKYKRLVD−−−EEVDNEETDQYELLANRHVLNGSILSILQTVIALLV−−−LLI−−−−−−−−−−−−−−FVVGQAEANGILFFLIPFFASGIFNTQFTLFNRRFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKSRRFY 
fig|1323661.3.peg.359   Staphylococcus aureus CA-347     MKILRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATRNNVVVISIIATMIIILIEIIVLMNQRRALKYKRLVD−−−EEVDNEETDQYELLANRHVLNGSILSILQTVIALLV−−−LLI−−−−−−−−−−−−−−FVVGQAEANGILFFLIPFFASGIFNTQFTLFNRRFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKSRRFY 
fig|931448.3.peg.906   Staphylococcus aureus subsp. aureus CIG1612     MKILRYIGYLLLGGLVGGIIGGILGNFDGFGIENLTFATYNNVVVISIVATIIIILVEAIVLMNQRRALKYKQLVD−−−KEVDIDATDQYELLANRYVLNGSILSILQTVIAFLV−−−LLI−−−−−−−−−−−−−−FVVGHAAANAILFFLIPFFASAIFNTQFTLFNRRFDDRIPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|553594.3.peg.1324   Staphylococcus aureus A9765                                          FATYNNVVVISIVATIIIILVEAIVLMNQRRALKYKQLVD−−−KEVDIDATDQYELLANRYVLNGSILSILQTVIAFLV−−−LLI−−−−−−−−−−−−−−FVVGHAAANAILFFLIPFFASAIFNTQFTLFNRRFDDRIPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|450394.6.peg.2116   Staphylococcus aureus subsp. aureus USA300_TCH959     MKILRYIGYLLLGGLVGGIIGGILGNFDGFGIENLTFATYTNVVVISIVATIIIILVEAIVLMNQRRALKYKRLVD−−−EEVDIDATDQYELLANRYVLNGSILSIIQTIIAFVV−−−LLI−−−−−−−−−−−−−−FVVGQAEANGILFFLIPFFVSAIFNTQFTLFNRRFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIVVIGLYSITTGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|282459.5.peg.343   Staphylococcus aureus subsp. aureus MSSA476     MKILRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATYTNVVVISIVATIIIILVEAIVLMNQRRALKYKRLVD−−−EEVDIDATDQYELLANRYVLNGSILSVIQTIIAFVV−−−LLI−−−−−−−−−−−−−−FVVGQAEANAMLFFLIPFFASAIFNTQFTLFNRKFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|1169274.3.peg.298   Staphylococcus aureus M1309     MKILRYIGYLLLGGIVGGIIGGILGNFDGLGIENLTFATYNNVVVISIVATMIIILVEAIVLMNQRRALKYKRLVD−−−EEVDIDATDQYELLANRYVLNGSILSVIQTIIAFVV−−−LLI−−−−−−−−−−−−−−FVVGQAEANAMLFFLIPFFASAIFNTQFTLFNRKFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|158879.11.peg.354   Staphylococcus aureus subsp. aureus N315     MKILRYIGYLLLGGIVGGIIGGILGNFDGLGIENLTFATYNNVVVISIVATMIIILVEAIVLMNQRRALKYKRLVD−−−EEVDIDATDQYELLANRYVLNGSILSVIQTIIAFVV−−−LLI−−−−−−−−−−−−−−FVVGQAEANAMLFFLIPFFASAIFNTQFTLFNRKFDDRMPKIADKNYTEKRLEILDEGERHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIFIYNAFSYLLKRRRFY 
fig|536229.4.peg.2470   Bacillus pumilus ATCC 7061                 GALLGFLGAYCLLAAEFEMTLLDIAFEA−−−−−−−TLVISGLTIVLIVYCF−−−SGISRMKKRVS−−−LSVSGDEEDELEAKQYRTFTDSTLSNTVSTILSIIA−−−TGM−−−−−−−−−−−−−−AIVTEQPIWLILVNVALFIVTIISSYVAISVLQLVYPNRNLPSPSDKDYSKKLLAISDEGEKHVMLGGLFHTYQMMNILLTSAMFILIVYSLGANHSQLFSIIVIGLVLIILNANYMFRIRN   
fig|315750.8.peg.3701   Bacillus pumilus SAFR-032                                         SFEA−−−−−−−TLVISGLTIVLIVYCF−−−SGISRMKKRVS−−−FSVSGDEEDELEAKQYRTFTDSTLANTVSTILSIIA−−−IGM−−−−−−−−−−−−−−AIVTELPIWLILVNVALFIITIISSYVALSVLKLVYPNRNLPSPTDKDYNKKLLAISDEGEKHVMLGGLFHTYQMMNILLTGAMFILIVYSLGANHSQLFSIIVIGVVLILLNANYMFRIRN   
fig|396513.4.peg.1835   Staphylococcus carnosus subsp. carnosus TM300          YISKVLLGGIVGGVICFLFSLHSGIKL−−−PTFLNTFDTQVSTGITILIVIICGIFMLKYLKNAYNYKQKSEIQEDFADEYNQTYNQTYNQKFLKAGWFYQATIIITLLN−−−MIFV−−−−−−−−−−−−−AIFKEDMNDQWGLTTIPLLISAVFGISYNVILPKIDSRLPKYNDSNYIGKMISAMDEGEKYISYSALFKLYHYNVMAVMMMIILLAFYSAVTHTDQIIALLVLIALYIFNVVFYYAKISKYYK
fig|760570.3.peg.476   Streptococcus parasanguinis ATCC 15912         RNVGIITVSGLIGGVIGFLTGMFGSEKPLEIQSFFS−−−IEVLLLGSILLFLIVFMVTIALLISARKIHQKML−−−QIEDEEEAYHYDIQKKKLYGLATIFKCIMILPYFLV−−−IIFYSQWVYMDRPSTGHLAFIFGTFTMLYLFLVLIVLFFLSDIFFRKTFHMLYGKPIPRNANAKEVREFMMSMMDEAEKQISYEENFEVVVKLSNYVLPISLIAIFLVGIAFHTDILLALVVVSLIYVYILVSQYKITKRYYK
fig|160491.17.peg.761   Streptococcus pyogenes str. Manfredo                 GGIIGGMVGAFLGYHGER−−LDQLTFLKDDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TIEEDDYSENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLILTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|319701.6.peg.1156   Streptococcus pyogenes MGAS6180                 GGIIGGMVGAFLGYHGER−−LDQLTFLKDDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TIEEDDYSENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|370552.3.peg.1200   Streptococcus pyogenes MGAS10270                 GGIIGGMVGAFLGYHGER−−LDQLTFLKDDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TIEEDDISENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLILTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|370554.4.peg.1268   Streptococcus pyogenes MGAS10750                 GGIIGGMVGAFLGYHGER−−LDQLTFLKDDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TIEEDDISENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVRSATMTRQFYR
fig|198466.1.peg.1056   Streptococcus pyogenes MGAS315                 GGIIGGMVGAFLGYHGER−−LDQLTFLKDDVINLIILLNRLVVVTDLTLSFVFLTQLKKETAVYN−−−TIEEDDISENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−TIPLLDILLLLMVIPFQALAMKCYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|293653.4.peg.1169   Streptococcus pyogenes MGAS5005                 GGIIGGMVGAFLGYHGGR−−LDHLTFLKDDVINLIILLNRLVVVTDLTLSFVFLTQLKKETAVYN−−−TIEEDDISENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|286636.1.peg.1105   Streptococcus pyogenes MGAS10394                 GGIIGGMVGAFLGYHGGR−−LDHLTFLKDDVINLIILLNRLVVLTGLTLSFVFLTQLKKETAVYN−−−TVEEDDISENGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFVYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|186103.1.peg.1151   Streptococcus pyogenes MGAS8232                 GGIIGGMVGAFLGYHGGR−−LDHLTFLKDDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TVEEDDYSEKGYRQLNKKHAYTMLLIAVASILSMCNVLLVLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMVIPFQALAMKRYNAIRGTDVPYFPNLKELKHNIMALDEAELQAYHKTSFESVLSLNGVIIPSLYVILFFIYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|759913.3.peg.1383   Streptococcus dysgalactiae subsp. equisimilis AC-2713                 GGIIGGMVGAFLGYHGGR−−LDHLTFLKEDVINLIILLNRLVVVTGLTLSFVFLTQLKKETAVYN−−−TVEEDDYSEKGYRQLNKKHAYTMLLIAVASILSMCN−−−VLLGLTLTND−−−−SQHAML−−−−−AIPLLDILLLLMTIPFQALAMKRYNAIRGTNVPYFPNLKELKHNIMALDEAELQAYYKTSFESVLSLNGSIIPSLYVILFFIYLFTGQVELTAILVLVLIQLYLLVKSATMTRQFYR
fig|388919.8.peg.683   Streptococcus sanguinis SK36       VLYNVLIFLAGALIGGLSIL−−−−FSETGLLKNISWSTIFSVQLLRQLGRASLIILYPLVFFLIYRTRKYNEAYE−−−KEADEDKNYEWYRLTFKNLEYATIVFNISSAIVLFT−−−ILVGVVFIGN−−ITNHKSPL−−−−−QWSFIDYAIAFLYIILQVVFLKTVQKVRHYKLSAFPTTEEIKEFALSYDESELQANYEQCYLILFNVNQRLLPALYVILGIVGVFTPLNVVSGFVILVVIHIYINLMYYPMVRKYFK
fig|888809.3.peg.597   Streptococcus sanguinis SK72       VLYNVLIFLAGALIGGLSIL−−−−FSETGLLKNISWSTIFSVQLLRQLGRASLIILYPLVFFLIYRTRKYNEAYE−−−KEADEDKNYEWYRLTFKNLEYATIVFNISSAIVLFT−−−ILVGVVFIGN−−ITNHKSPL−−−−−QWSFIDYAIAFLYIILQVVFLKTVQKVRHYKLSAFPTTEEIKEFALSYDESELQANYEQCYLILFNVNQRLLPALYVILGIVGVFTPLNVVSGFVILVVIHIYINLMYYPMVRKYFK
fig|388919.9.peg.729   Streptococcus sanguinis SK36                          M−−−−FSETGLLKNISWSTIFSVQLLRQLGRASLIILYPLVFFLIYRTRKYNEAYE−−−KEADEDKNYEWYRLTFKNLEYATIVFNISSAIVLFT−−−ILVGVVFIGN−−ITNHKSPL−−−−−QWSFIDYAIAFLYIILQVVFLKTVQKVRHYKLSAFPTTEEIKEFALSYDESELQANYEQCYLILFNVNQRLLPALYVILGIVGVFTPLNVVSGFVILVVIHIYINLMYYPMVRKYFK
fig|469609.3.peg.1521   Streptococcus sp. 2_1_36FAA                                             FLNVELLQTIGRVCLTILYPLTFYLIYQTNKYHVSME−−−KEEDEDKEYELYRRSFKTLESVTILFNITSALTLFT−−−LFVGVKYAFS−−SLEADSVF−−−−−WINPYNGVILLALIIGQIVLLKTTQKIRKYKLSMAPTVEEMKKFAFSFDEGELQANYEQSFLILFNLNQWVIPSLYVLIWLVGLLTPMNVVSAYIVLTIIFIYINVMFYPMVKKYFK
fig|467705.8.peg.1517   Streptococcus gordonii str. Challis substr. CH1      RIMRNVIFLILAIIIGGVIGFFAGR−−−−−−IEHISWPSFLNVGLLQNIGRVCLTILYPFTFYFIYQANKYHQSME−−−KEEDEDKEYELYRQTFKTLESVTILFNVTSALTLFT−−−LFVGVNYVFP−−LLEAGSVF−−−−−WINLYDGVILLALVIAQIVLLKTTQKIRKYKLSIAPTVEEMKKFAFSFDEGELQAHYEQSLLILFNLNQWVIPGLYILMFLVGLLTPMNVVSAYIVLTIIFIYINVMFYPMVKKYFK
fig|981539.3.peg.671   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143          RILIYLGIAVVGLLVGVLAGYLSIDFNENILTFK−−−−FATFMILAYGLTAISIVVTLWFMYQANHYHDRYESLGNDTDEDDSYEVYRKTFKNLEFARIFYNVSMALILFS−−−LFGGLYDFQDKILSDESLSL−−−−−GTYVMDIIFLALLFIFQAAIFKLTQKIRHYKLSAFPTIKEVKEFAYSYDEGKLQANYEQAFLIVFNLNQFLPIAYVVLYILAIVSSIDVTSGLVVTTAIYLYINLANIRFVNKYFR
fig|218494.4.peg.1018   Streptococcus suis P1/7         RYSAYMLISAILGGFIGFFGIL−−−−−−IFKFSLPSYLNLDNFLICLRIITFLIFAGTVYFGVKANQNYKLYHSISDEDEEHVDELYKKMYRNLEYATISFNVAVSLTLLN−−−LVLGFGVTFF−−−−EDGAIM−−−−−YGSIFDVVFYVILLISQIFIMKLTQKIRDYKLSAFATVKEMKDFAEAMDEGEKQANYEMSFQIVFTLNQIVLPGLYLFLFVLSMLLQERQITAFLVVAFLHIYINVMQVRMIRRYFK
fig|760570.3.peg.1723   Streptococcus parasanguinis ATCC 15912                        IGMFGVAFT−−−−NLHLNISQEQVQFILTTIFFCLGILSTIVALYFIMNSRKVYASYL−−−AEEDDELNELAYIKMYRSLDYGTVAYNVLQVSMLFS−−−LLTVLPSH−−−−−−−−−−−−−−−−−DLPISAFLLAVLTILVGSFCIKTTSKIRNYQLSILATPKEVLDYLETYDEGEKQAEMEEAYLILFKLNQLILPSVYIILFALSIILGEVQLVAALITAVIHLYINIAQLRKTKRYFK
fig|655813.4.peg.795   Streptococcus oralis ATCC 35037                   IIGALLGILAGALG−−−−VKPLGISQEQVIPVLFSIFFGLGLITAILTFYFTRKSHQAYQNYQ−−−REEEDEGNEQDYLAMYRFLDYGTVAWNVSQISMLFC−−−MLLDLGRF−−−−−−−−−−−−−−−−−GISATSLLLIVVSIWSGVYCLKITSKIRNYKLSVMATPKEVLDYLDTYDEGEKQAEMEEAYLILFKVNQLLIPGIYIVLVILSMVLGQVQLVALLVAVVIHLYTNVAQLRKTKRYFK
fig|365659.3.peg.132   Streptococcus mitis B6     MKKKRGLLLFLMSIVLGVFLAMFVGMFKALAESHGIMLDVKVLILWISAICLVLGFISILLTFNFLKKSRKFHSLYQ−−−EEMDDDQNESYYVQMYRNLEFGTIAFNIASVAILLA−−−FFISGCE−−−−−−−−−−AIVLNGSHLTLSLSFLALVLIFSVQKYLFKTIAIVRQFDLAFFSTPKDVMDFINSYDEGERQANLEQSFRILFQLHQYVLPGLYILIDLFSLLTGEIQLLAFLLVGAIHVYINVMQLPIVKRYFK
fig|246201.1.peg.1774   Streptococcus mitis NCTC 12261     MKKKHGLLFLMSVVLGAFLGMFVGMFKARAESHGIMLDVKVLVPWISAICLLIGFISILLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRDLEFGTIAFNIANVAILLA−−−LFIAGSE−−−−−−−−−−VXILNGSFLTLSLSFLLLVLVFNVQKYLFKTIAIVRQFDLAFFSTPK                                                                               
fig|563037.3.peg.98   Streptococcus sp. M143     KKKKRGLLFLMSVVLGGFLGGFVGMFKAVAESHEIMLDVKVLIPWISAICLLLGFISILLTFNFLKKSRKFHSLYQ−−−EEMDDELNETYYVQMYRNLEFGNIAFNIASVAISLS−−−IFLSLNE−−−−−−−−−−VVILHTGHQTFSLSFLAFVLLLVAQKSLSKTIAIVRQFDLSLFSTPKDVLDYINSYDEGERQANLEQSFRILFQLHQYVLPALYVFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|1313.4.peg.1023   Streptococcus pneumoniae INV200     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMLLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|406557.4.peg.1854   Streptococcus pneumoniae SP6-BS73                                                                                       MDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|406558.4.peg.92   Streptococcus pneumoniae SP9-BS68     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNIIGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|760785.3.peg.2097   Streptococcus pneumoniae GA17301     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNIIGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|760816.3.peg.2054   Streptococcus pneumoniae GA43257     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNIIGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|453361.3.peg.722   Streptococcus pneumoniae CDC1087-00     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|1239789.3.peg.2301   Streptococcus pneumoniae 1488     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|760800.3.peg.774   Streptococcus pneumoniae GA19690     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|1239787.3.peg.2272   Streptococcus pneumoniae 3051     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIILSFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|488221.3.peg.2253   Streptococcus pneumoniae 70585     MKKKRRLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIILSFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|487214.3.peg.2237   Streptococcus pneumoniae Hungary19A-6     MKKKRRLLFLMSIVLGGVLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|886289.3.peg.2065   Streptococcus pneumoniae GA17545     MKKKRRLLFLMSIVLGGVLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|406561.4.peg.1230   Streptococcus pneumoniae SP18-BS74                         GMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|406561.5.peg.1249   Streptococcus pneumoniae SP18-BS74                          MFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|914137.3.peg.2100   Streptococcus pneumoniae 2081074                          MFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|1105121.3.peg.2042   Streptococcus pneumoniae GA58771     MKKKRRLLFLMSIVFGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|760822.3.peg.2025   Streptococcus pneumoniae GA44288     MKKKRRLLFLMSIVFGGFLGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|1159082.3.peg.68   Streptococcus pneumoniae PCS8203     MKKKRRLLFLMSIV−−−−LGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|760765.3.peg.2154   Streptococcus pneumoniae GA11663     MKKKRRLLFLMSIV−−−−LGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK
fig|516950.3.peg.2181   Streptococcus pneumoniae CGSP14     MKKKRRLLFLMSIV−−−−LGMFVGMFKARVESHEIILDVKALMPWISAICLLIGFISMFLTFNFLKKSRKFHSLYQ−−−EEMDDDLNETYYVQMYRNLEFGTIAFNITGVAIPLA−−−IFISLSE−−−−−−−−−−VIILHTNPQTFFLSFLLFVVFLVAQKSLFKTIAIVRQFDLEFFATPKDVLNYINSYDEGERQANLEQSFRILFQLHQYVLPALYIFLIIISFLTGEIQLLAFLLVGAIHVYINVMQLPMVKRYFK