(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00013394

fig|279808.8.peg.2060   Staphylococcus haemolyticus JCSC1435     MNIEIIANEFETRAATLLRYFTGLCESSYKLPFAFKIYNDPFNVVYLVSKGKMYAHVLIKDCEVRKTFEIASEKHTEKLIESIEGHYTGYDLHDGTHDTISDMMASFMFDNEYFMYGLETFAESNNSDMFDYMSRDFNIDELEGVQSSNADVIGNMEALYQLATGINEPAPELVEGLKIITEFIQNEKANEVDSKALIKRLNELKQSYYDGVK
fig|629742.3.peg.504   Staphylococcus hominis SK119     MNVEIIANEFETRAATLLRYFTGLCESSYKLPFAFKIYNDPFNVVYLVSKGKMYAHVLIKDCEVRKTFEIASEKHTEKLIESIEGYYAGYELPDGTHDTISDMMASFMFDNDYFMYGLETFAESNNSDMFDYMSKDFNIDELEGVQTSNADVIGNMEMLYQLATGINEPAPELVEGLKIITEFIQNEQANEVDSKVLIERLNELKHSYYKGVK
fig|904346.3.peg.841   Staphylococcus lugdunensis VCU139     MNIEIIANQFETRAAALLRYYTGLLESSKKTPFGFKIYNDPFDMVYVVMEGNLYGHIYIKDCNVRKAFELASPKHTEGLIRSIEGHYAGYEIPDGTHDTISDMMASFMFDNDYFMYGLETFAESNNTDMFTYIEGGLNVEELEGVQSSNADVIGNIEILYQLATGINEPASELVEGLKLVTAFVQDENATLDDYKALERKLSELKSSYYSLSK
fig|596319.3.peg.1413   Staphylococcus warneri L37603     MNIEIIANQFETRAGTLLRYYTGLLESSRKTPFGFKIYNDPFDMVYVVMESNLYGHIYIKDCNVRKAFELASPKHTEGLIRSIEGHYAGYEIPDGTNDTISDMMASFMFDNDYFMYGLETFAESNNTDMFEYMEKDFGVEELEGIQSSNADVIGNMEVLYQLATGINEPATELVEGLKLVTEFVQDENATQDDYTALERKLSELKASFYSLNK
fig|525376.3.peg.1183   Staphylococcus epidermidis W23144     MNIEIIANQFETRAGTLLRYYTGLLESSRDNHFAFKIYNDPFDMVYVMMNEKLFGHVYIKDCNVRQSFELASPKHTEGLIRSIEGHYAGYEIPDGTHDTISDMMASFMFDNDYFMYGLETFAESNNTDMFEYMEKDFGVDELEGIQSSNADVIGNIEMLYQLATGINEPAPELVEGLKLVTGFVQDEHATQDDYKALERKLNELKESYYSVSK
fig|525374.3.peg.2051   Staphylococcus epidermidis BCM-HMP0060     MNVEIIANQFETRAGTLLRYYTGLLESSRETPFGFKIYNDPFDMVYVVMNGNLYGHIYIKDCNVRKAFELASPKHTEGLIRSIDGYYAGYELHDDKTLSISDMMADNLFNDEFFMYGLQTYAESNNSDVFDYMEKGFDSDTVEGIQSSNADVIGNIEMLYQLATGINEPATELVEGLKLVTAFVQDENATQDDYKTLERKLSELKESYYSVSK
fig|158878.1.peg.794   Staphylococcus aureus subsp. aureus Mu50     MNIETVVNEFETRAGTLLRYYTGLLESSRETHFAFKIYNDPFDMVYVMMKGKLYGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|585151.3.peg.1725   Staphylococcus aureus subsp. aureus C427     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPYCFKLYNDPFDMVYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|158878.1.peg.2019   Staphylococcus aureus subsp. aureus Mu50     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|158879.11.peg.1976   Staphylococcus aureus subsp. aureus N315     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|1233245.3.peg.1538   Staphylococcus aureus M2     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMAYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPATELVEGLKLVTEFVQDENATQEDYTALERKLNDLKASYYSISK
fig|698737.3.peg.1938   Staphylococcus lugdunensis HKU09-01     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDIVYVMMNGKLFGHVYIQDCNVRQSFELATPKHTEGLIRSIEGHYTGYEIEDDKHISISDMMASQLFEDEYFMYGLETYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPALELVEGLKLVTEFVQDEKATQEDYKALERKLNDLKASYYSLSK
fig|585151.3.peg.2261   Staphylococcus aureus subsp. aureus C427     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMAYVMMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLRLVTEFVQDENATQEDYKALEHKLTELKSSYYSLNK
fig|931447.3.peg.2669   Staphylococcus aureus subsp. aureus CIG1233     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMAYVMMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLRLVTEFVQDENATQEDYKALEHKLTELKSSYYSLNK
fig|585146.3.peg.1343   Staphylococcus aureus subsp. aureus 68-397     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMAYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPEPELVEGLKLVTEFIQDENATQEDYKALEHKLTELKSSYYSLNK
fig|681288.4.peg.799   Staphylococcus aureus subsp. aureus ED98     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMAYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLRLVTEFVQDENATQEDYKALECKLNNLKASYYSLSK
fig|1006543.3.peg.354   Staphylococcus aureus subsp. aureus T0131     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLRLVTEFVQDENATQEDYKALECKLNNLKASYYSLSK
fig|553594.3.peg.2796   Staphylococcus aureus A9765     MNIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFKCLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|931442.3.peg.1505   Staphylococcus aureus subsp. aureus CIG547     MNIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFKCLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|931442.3.peg.1047   Staphylococcus aureus subsp. aureus CIG547     MNIETIVNEFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVVMNNKLFGHVYIKDCKVRKSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYVESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPARELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|931447.3.peg.962   Staphylococcus aureus subsp. aureus CIG1233     MNIETIVNEFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVVMNNKLFGHVYIKDCKVRKSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYVESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPARELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|273036.6.peg.2007   Staphylococcus aureus RF122     MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISYMMASQLFEDEYFMYGLETYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|273036.6.peg.388   Staphylococcus aureus RF122     MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDVMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVISNIEMLYQIATGINEPAPELVEGVRLVTEFVQDEKATQEDYKALERKLNDLKTSYYSLSK
fig|553594.3.peg.2800   Staphylococcus aureus A9765     MNIEIIANQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMCYVVMNSKLFGHVYIKDCKVRQSFELASPKYTEGLIRSIEGHYVGYELHDGKQLSISDVMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPEPELVEGLKLVTEFIQDENATQEDYKALERKLNDLKASYYSLSK
fig|585152.3.peg.292   Staphylococcus aureus subsp. aureus D139     MNIENIVNQFETRAGTLLRYYTGLLEHSKVQPYCFKLYNDPFDMCYVVMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFKYLENGFDTDTLEGIQSSNTDVISNIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSK
fig|644279.4.peg.447   Staphylococcus aureus subsp. aureus 132     MNIEIIVNQFETRAGTLLRYYTGLLEHSKVQPYCFKLYNDPFDMVYVMMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEDIQSSNTDVISNIEMLYQIATGINEPARELVEGLKLVTEFVQDENATQEDYKALESKLNDLKESYYSLSK
fig|585152.3.peg.1988   Staphylococcus aureus subsp. aureus D139     MNIEIIANQFETRAGTLLRYYTGLLEHSKVQPYCFKLYNDPFDMVYVMMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDVMASQLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVISNIEMLYQLATGINEPAPELVEGLKLVTEFVQDENATQEDYKALERKLTELKSSYYSLNK