(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020674

fig|451516.9.peg.1438   Staphylococcus aureus subsp. aureus USA300_TCH1516     MKMTNPTRTKRCGGDVLYGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|585152.3.peg.1398   Staphylococcus aureus subsp. aureus D139     MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKK   
fig|585158.3.peg.1868   Staphylococcus aureus subsp. aureus M876     MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|158879.11.peg.1343   Staphylococcus aureus subsp. aureus N315     MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|1235278.3.peg.1347   Staphylococcus aureus PPUKM-775-2009       MTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|282458.1.peg.1348   Staphylococcus aureus subsp. aureus MRSA252                  GDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|282459.5.peg.1410   Staphylococcus aureus subsp. aureus MSSA476                  GDVLCGIDNHFQLLLYISENHCQLEIKTFFEYFLRIVNKTHDYAILENKKICI
fig|93062.19.peg.1416   Staphylococcus aureus subsp. aureus COL                 GGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI
fig|359787.11.peg.1542   Staphylococcus aureus subsp. aureus JH1                 GGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILENKKICI